DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS36

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:294 Identity:89/294 - (30%)
Similarity:128/294 - (43%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALTNGAVIPIGLEPQTSSLG-----GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVT 72
            |..:.|:.|...||:....|     .|||||:.:.....||||||...|.|.||||:|:.:.:::
Human    20 AFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLS 84

  Fly    73 AAHCLDTPTTVSN-------LRIRA------GSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGV 124
            ||||..|..|:..       |.:.:      |::.|.       ||||.....|:......|:.:
Human    85 AAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRA-------VAAIVVPANYSQVELGADLAL 142

  Fly   125 VRLKTKLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTDGPSSA--TLLFVDTRIVGRSQCG 185
            :||.:..:.|..:..:.:  ||....||:|...:|||......|...  .|..|:.|::|.:.|.
Human   143 LRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQ 207

  Fly   186 SSTYGYGSF-----IKATMICAA--ATNKDACQGDSGGPLV--SGGQ--LVGVVSWGRDCAVANY 239
            ......|.|     |...|:||.  ...:|.||||||||||  .||:  ..|:.|:|..|...|.
Human   208 CLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNR 272

  Fly   240 PGVYANIAELRDWV--------------LQAQKT 259
            |||:..:|....|:              .|.|||
Human   273 PGVFTAVATYEAWIREQVMGSEPGPAFPTQPQKT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 78/246 (32%)
Tryp_SPc 35..253 CDD:238113 77/245 (31%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 78/246 (32%)
Tryp_SPc 47..289 CDD:238113 78/248 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 4/15 (27%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.