DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Try5

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:259 Identity:91/259 - (35%)
Similarity:136/259 - (52%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLALTN-GAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |||.|.: ||.:...::..     .:||||........|:|||| .||.||||||:|::..:|:|
  Rat     3 ALLFLAHVGAAVAFPIDDD-----DKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    74 AHCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFG 134
            |||..:...|    .|:.:..|:.:      .|..|.|..|..:|:.:..|||.:::|...:|..
  Rat    62 AHCYKSRIQVRLGEHNINVLEGNEQ------FVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLN 120

  Fly   135 STIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKAT 198
            |.:..:.:.|:....|:...|||||.|.:.|.::..|| .:|..::.::.|.:|   |...|...
  Rat   121 SRVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEAS---YPGKITNN 182

  Fly   199 MICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            |||..  ...||:||||||||:|..|||.|:||||..||:.:.||||..:....||:   |.|:
  Rat   183 MICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI---QDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/225 (36%)
Tryp_SPc 35..253 CDD:238113 82/224 (37%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 82/225 (36%)
Tryp_SPc 24..242 CDD:238113 84/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.