DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and LOC101730988

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_012810074.1 Gene:LOC101730988 / 101730988 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:234 Identity:87/234 - (37%)
Similarity:130/234 - (55%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTV----SNLRIRAGSNK 94
            :|:||...:....|:.||| .:|.||||||:::|..:|:||||......|    .|:.:..|:.:
 Frog    20 KIIGGATCAKNSVPYIVSL-NAGYHFCGGSLLNNQWVVSAAHCYQASIQVRLGEHNIALSEGTEQ 83

  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWG 159
                  .:..|.:..|.:|||.:..|||.:::|.:..:..|.:||:::.|:..|.|::..:||||
 Frog    84 ------FINSAKVIRHPSYNSRTTDNDIMLIKLASPASLNSYVKAVSLPSSCAAAGTSCLVSGWG 142

  Fly   160 KTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSG 221
            .||..|.:...|| .::..|:..:||.|:   |...|...|.||.  ...||:||||||||:|..
 Frog   143 NTSASGSNYPNLLQCLNAPILTTAQCSSA---YPGQITNNMFCAGFLEGGKDSCQGDSGGPVVCN 204

  Fly   222 GQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            |||.|:||||..||..|||||||.:.....|:   |.|:
 Frog   205 GQLQGIVSWGIGCAQRNYPGVYAKVCNYNSWI---QSTI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 84/225 (37%)
Tryp_SPc 35..253 CDD:238113 84/224 (38%)
LOC101730988XP_012810074.1 Tryp_SPc 21..239 CDD:238113 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.