DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and LOC100485189

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:237 Identity:83/237 - (35%)
Similarity:113/237 - (47%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGS-NKRTY 97
            ||:|||......:||..||.....|.|||.:|..|.::|||||     .:|:|::|.|. |...|
 Frog    21 RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC-----QLSSLQVRLGEHNLAVY 80

  Fly    98 GGVLVEVAAIK--AHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGK 160
            .|......|.|  .|..:|..:..|||.:::|.:.:|....::.|.:...|...|....:||||.
 Frog    81 EGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQTIPLGCPTVGDGETCLVSGWGT 145

  Fly   161 TSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSF----IKATMICAAAT--NKDACQGDSGGPLV 219
            |::  |...   |.|.......|..|..|..|:|    |...|:||...  .||:||||||||||
 Frog   146 TTS--PEET---FPDELQCVEVQTVSQDYCQGAFPTDEITDNMLCAGVMEGGKDSCQGDSGGPLV 205

  Fly   220 SGGQLVGVVSWGR-DCAVANYPGVYANIAELRDWVLQAQKTV 260
            ....:.|:.|||. .|.|||.||:|..|.....|:   |.|:
 Frog   206 CNSMVHGITSWGNTPCGVANKPGIYTKICNYIAWI---QDTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/228 (35%)
Tryp_SPc 35..253 CDD:238113 79/227 (35%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.