DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Gm2663

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:126/260 - (48%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIV 71
            |||       ||.:.:   |..|.  .:||||........|:||||....||.||||:|::..::
Mouse     8 TFL-------GAAVAL---PANSD--DKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVL 60

  Fly    72 TAAHCLDTPTTVSNLRIRAGSNKRTY---GGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTF 133
            :||||..     ..|::|.|.:....   |...::...|..|..||.::..|||.:::||:....
Mouse    61 SAAHCYK-----RRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAIL 120

  Fly   134 GSTIKAITMASATPAHGSAASISGWGKT-STDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKA 197
            .|.:..:::..:..:..:...:||||.| |..|...|.|..::..::..|.|..|   |...|.:
Mouse   121 NSQVSTVSLPRSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS---YPGQITS 182

  Fly   198 TMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            .|.|..  ...||:|.||||||:|..|::.|:||||..||:...||||..:.....|:   |:|:
Mouse   183 NMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI---QETM 244

  Fly   261  260
            Mouse   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/224 (32%)
Tryp_SPc 35..253 CDD:238113 72/223 (32%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 72/224 (32%)
Tryp_SPc 24..243 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.