DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18278 and Arsi

DIOPT Version :9

Sequence 1:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001033588.1 Gene:Arsi / 545260 MGIID:2670959 Length:573 Species:Mus musculus


Alignment Length:382 Identity:95/382 - (24%)
Similarity:147/382 - (38%) Gaps:93/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NTASEKLPNILLILSDDQ---DVELRGMFPMEHTIEMLGFGGALFHNAYTPSPICCPARTSLLTG 78
            :.|..:.|:|:.||:|||   ||...|......|::.|...|....|.|. .|||.|:|:.||||
Mouse    40 SVAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYI-QPICTPSRSQLLTG 103

  Fly    79 MYAHNHGTRNNSV---SGGCYGPHWRRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVP--K 138
            .|..:.|.:::.:   ...|.      .|:...||..||:.||:|...||:...::....:|  :
Mouse   104 RYQIHTGLQHSIIRPRQPNCL------PLDQVTLPQKLQEAGYSTHMVGKWHLGFYRKECLPTRR 162

  Fly   139 GWNHFYG-LHGNSRYYNYTLRENSG----NVH--------YESTYLTDLLRDRAADFLRNATQSS 190
            |::.|.| |.||..||.|...:..|    ::|        ....|.|.|...||:..|.:....:
Mouse   163 GFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGLSGQYSTMLYAQRASHILASHNPQN 227

  Fly   191 EPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSFNQVKQDKHWLVRAARRLPNETINTIDTY 255
             |.|..||..|.|.|                |::|        :.:|.|         ..|:...
Mouse   228 -PLFLYVAFQAVHTP----------------LQSP--------REYLYR---------YRTMGNV 258

  Fly   256 FQKRWETLL-AVDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVGQFAQPFDKRQPYETDINVPL 319
            .::::..:: .:||.|..:...|.......|:.||::||||            .|.:....|.||
Mouse   259 ARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNG------------GQTFSGGSNWPL 311

  Fly   320 L----------IRGPGIAPESHID-------TAVSLVDLAPTILAWADIDTPSYMDG 359
            .          :||.|......:.       ..|.:.|..||::..|. .|.|..||
Mouse   312 RGRKGTYWEGGVRGLGFVHSPLLKKKRRTSRALVHITDWYPTLVGLAG-GTTSAADG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18278NP_725289.1 G6S 24..467 CDD:293766 94/375 (25%)
AslA 24..464 CDD:225661 94/375 (25%)
ArsiNP_001033588.1 AslA 47..492 CDD:225661 94/375 (25%)
4-S 47..478 CDD:293753 94/375 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 515..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.