DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18278 and CG7402

DIOPT Version :9

Sequence 1:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster


Alignment Length:558 Identity:133/558 - (23%)
Similarity:209/558 - (37%) Gaps:135/558 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIILVLACL-----GNTASEKLPNILLILSDD---QDVELRG----MFPMEHTIEMLGFGGALFH 59
            |::||::.:     |:..|.| |||::||.||   .||...|    :.|   .|:.|.:.|.|.:
  Fly     7 LVLLVVSSILSLAYGSGYSTK-PNIVIILIDDMGMNDVSFHGSNQILTP---NIDALAYNGILLN 67

  Fly    60 NAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGYNTFFGG 124
            ..|.|: :|.|:|.:||||.|..:.|.::..:   .....|......|.:|.|.:..||:|...|
  Fly    68 KHYVPN-LCTPSRATLLTGKYPIHTGMQHFVI---ITDEPWGLPQRERLMPEIFRDAGYSTHLVG 128

  Fly   125 KYLNQYWGAGDVP--KGWNHFYGLH-GNSRYYNYTLRENSGNV--------------HYESTYLT 172
            |:...:|.....|  :|::|.:|.: |...||::.:|....|.              ....||.|
  Fly   129 KWHLGFWRKDLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPCPEANGTYAT 193

  Fly   173 DLLRDRAADFLRNATQSSEPFFAMVAPPAAH-----EPFTPAPRHE-GVFSHIEALRTPSFNQVK 231
            :.....|...:.. ...|:|.|.:::..|.|     .|. .||..| ..|.||   |.|.     
  Fly   194 EAFTSEAKRIIEQ-HDKSKPLFMVLSHLAVHTGNEDSPM-QAPEEEVAKFPHI---RDPK----- 248

  Fly   232 QDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENTYIIYTSDN-- 294
                      ||          ||.    ..:.::|:.|...:|.|.|...|.|:.|:..|||  
  Fly   249 ----------RR----------TYA----GMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGA 289

  Fly   295 ---GYHVGQFAQ-PF--DKRQPYETDINVPLLIRGPGIAPESHI-DTAVSLVDLAPTILAWADID 352
               |.|....:. |:  .|..|:|..|.....:..|.:....:: :.|:..||..||:...|.:.
  Fly   290 PTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVS 354

  Fly   353 TPS--YMDGQSFHELLLNKRRRVPFFERSLLIEYWG-----EGTLATFNPECPWPEKDRLAQCTP 410
            .|.  .:||.:...:|.......|.....:|.|.:|     ..||...|..   ..|.|..|...
  Fly   355 LPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGS---SFKGRYDQWLG 416

  Fly   411 AADCHCQDAWNNTY----------ACLRNIRHREDRI---------YCEFRDNENFLEA------ 450
            ..:.:..|....:|          :.|.|....:|||         .|...:.:|.||:      
  Fly   417 ELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEP 481

  Fly   451 ------YDLQLDPFQMTNIAYDLLPIERALYSLRLKNL 482
                  :||..||.:..|:|        .:|.|:|:.|
  Fly   482 LKAPCFFDLAKDPCERYNLA--------QMYPLQLQQL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18278NP_725289.1 G6S 24..467 CDD:293766 123/519 (24%)
AslA 24..464 CDD:225661 122/516 (24%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 115/478 (24%)
4-S 28..436 CDD:293753 108/451 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.