DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18278 and sul-2

DIOPT Version :9

Sequence 1:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_505102.1 Gene:sul-2 / 179194 WormBaseID:WBGene00006309 Length:452 Species:Caenorhabditis elegans


Alignment Length:283 Identity:64/283 - (22%)
Similarity:97/283 - (34%) Gaps:84/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ISLAPLIILVLA-------CLGNTASEKLPNILLILSDD---QDVELRGMFPMEHT-IEMLGFGG 55
            :||..|::..|:       |.....|.:.|||::::.||   .|:...|....|:| ::.:...|
 Worm     4 VSLLLLLLFPLSTFQQREDCTVQPPSPRHPNIVILMIDDLGYGDIASYGHPTQEYTQVDRMAAEG 68

  Fly    56 ALFHNAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEP----------RALP 110
            ..|..||:...:|.|:|...:||......|     :.||      ||...|          ..:.
 Worm    69 TRFTQAYSADSMCSPSRAGFITGRLPIRLG-----IVGG------RRVFVPYDIGGLPKSETTMA 122

  Fly   111 YILQQHGYNTFFGGKYLNQYWGAGDVPKGWNHFYGLH-GNSRYYNYTLRENSGNVHYESTYLTDL 174
            .:||:.||.|...||     |..|....  |...|.| .:.|.:.|.    ..|:.:.:.:..|.
 Worm   123 EMLQEAGYATGMVGK-----WHLGINEN--NATDGAHLPSKRGFEYV----GVNLPFTNVWQCDT 176

  Fly   175 LR---DRAAD----FLRNA-------------------------------TQSSEPFFAMVAPPA 201
            .|   |:..|    ||.:.                               .|...|||...:.|.
 Worm   177 TREFYDKGPDPSLCFLYDGDDIVQQPMKFEHMTENLVGDWKRFLMTRLAQDQHERPFFFYFSFPQ 241

  Fly   202 AHEPFTPAPRHEGVFSHIEALRT 224
            .|.....:.|..|  |..||||:
 Worm   242 VHSTQFASKRFRG--SSKEALRS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18278NP_725289.1 G6S 24..467 CDD:293766 58/254 (23%)
AslA 24..464 CDD:225661 58/254 (23%)
sul-2NP_505102.1 ALP_like 32..388 CDD:390042 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.