DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IMPPP and CG13749

DIOPT Version :9

Sequence 1:NP_725287.3 Gene:IMPPP / 36486 FlyBaseID:FBgn0283462 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_610428.2 Gene:CG13749 / 35894 FlyBaseID:FBgn0033353 Length:183 Species:Drosophila melanogaster


Alignment Length:165 Identity:102/165 - (61%)
Similarity:125/165 - (75%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGTYSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNR 82
            ||:.|.||||.:||||||:|||||||||||:|.|.||||||||.:|....:||||||.|.|:|::
  Fly    17 AADLQRTYDGHDGPHVFGTPGNQVYIRGQNDGVYKVPGVGGQFHHASSPADHVYTDEQGITYVHK 81

  Fly    83 KNAGGPASHTISGPNFSAKNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRS 147
            |:||||.:||:.||..:|.....:..:..|:     |:|||||||.|||||||:|||.:||.|||
  Fly    82 KDAGGPGTHTLRGPGLAAVQPAYSTVQPAGL-----RNPQFHVERSGRTVDVGSGGFVVQRSRRS 141

  Fly   148 PQLHVARPDRTVTIGNGGVYIQRSRRSPQFHVERP 182
            ||.||.||.|||.:|:||.::||.||||||.||||
  Fly   142 PQFHVERPGRTVDVGSGGFFVQRGRRSPQFPVERP 176



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.