DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IMPPP and CG30285

DIOPT Version :9

Sequence 1:NP_725287.3 Gene:IMPPP / 36486 FlyBaseID:FBgn0283462 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_726103.1 Gene:CG30285 / 246528 FlyBaseID:FBgn0050285 Length:112 Species:Drosophila melanogaster


Alignment Length:85 Identity:44/85 - (51%)
Similarity:57/85 - (67%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGTYSVPGVGGQFQNAPQ 65
            |:|..|:...:..::......|..||||||||.||:|||.:||||||||.|:||.:||.|||:|.
  Fly     1 MRSCTLLVFIVSTLLFAVTNAQQNYDGRNGPHEFGTPGNGIYIRGQNEGPYTVPEMGGTFQNSPS 65

  Fly    66 RGEHVYTDEAGNTFVNRKNA 85
            .|:|.||||.|||:.:...|
  Fly    66 SGQHSYTDEHGNTYTHSSTA 85



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.