DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17047 and CG14280

DIOPT Version :9

Sequence 1:NP_001286385.1 Gene:CG17047 / 36478 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001287405.1 Gene:CG14280 / 42312 FlyBaseID:FBgn0038695 Length:555 Species:Drosophila melanogaster


Alignment Length:374 Identity:85/374 - (22%)
Similarity:134/374 - (35%) Gaps:109/374 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GTCLTRFKCMRQSGTVNGYCGT-YGVCCETNLQVGSSTRQKRTIIKN---PGVLSSDLNTYTIEA 119
            |.|...|:|....|.....|.. .||||......|..|.|:....::   |..:...:....|..
  Fly   242 GVCYHEFECKSLGGIPTESCAEGVGVCCVFVNGCGDVTSQQILYFESPNYPNAVREMMICVLIIN 306

  Fly   120 FSSNVQQLRIDFEQFVMQQPTDVDGVLECQDYFEAGGFK-------LCGVNDGQHLYLPFNAAAG 177
            ....|||||:||:.|.:.:|::.|.|   .|.|...|..       |||:|.|||:|:.. ..:.
  Fly   307 VKKGVQQLRLDFQMFELSRPSNGDCV---DDQFIVSGHNTNFQIPILCGINTGQHIYIHV-GDSN 367

  Fly   178 VDQVTLTFVVTSRGTAPVWRLIVTQLEGPPANSRRRSSTSTGLGTSTNSLQDLRDIFASHHADYE 242
            ..:|.|:..:...|....:.:.|||::                                     :
  Fly   368 EGKVYLSVFMKVSGGGRSFNIKVTQVD-------------------------------------D 395

  Fly   243 LLAPPGCQQYYTDLSGTIRSFNFQT--SVTSN----YMPDLSYNICIRSATSASMIEYSFSKFSM 301
            .|||..|.||:.|..|.|:|||:.|  |:..|    |..:|:|.||:....:...:.|:      
  Fly   396 NLAPNNCLQYFHDAEGVIKSFNYDTDGSIVDNREATYFNNLNYAICLARLKNVCSVAYN------ 454

  Fly   302 SVQSDSGEGYDEFCHATVHTTGRQEDYLMI-----PQSILAKNMAYQPTYYCGTNDNLLVYASPP 361
                            |....|.|.|:.:|     ...:::...|....:.| .:|.:.:.:.|.
  Fly   455 ----------------TEQLGGDQPDFQIINKDEAENDLISDGQAGAGIFNC-PDDFIAINSVPL 502

  Fly   362 YMMHFS----SDDLTLN---RD----------------VETGFSMTYRQ 387
            ....|:    |||.|::   ||                |..||.:.|:|
  Fly   503 CGERFNDGRESDDYTIHATVRDTAAGPIILPFRTDSEYVGRGFRLLYKQ 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17047NP_001286385.1 None
CG14280NP_001287405.1 MPDZ_u10 132..>180 CDD:293272
CUB 275..391 CDD:238001 30/119 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.