DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17047 and CG13310

DIOPT Version :9

Sequence 1:NP_001286385.1 Gene:CG17047 / 36478 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648257.1 Gene:CG13310 / 39007 FlyBaseID:FBgn0035928 Length:401 Species:Drosophila melanogaster


Alignment Length:440 Identity:105/440 - (23%)
Similarity:170/440 - (38%) Gaps:107/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLLFPLGLLAIAQAQ------TLNDTASGALAVAQEPGMWRQARRRSVLA------DSCVTNSGT 57
            |||..|.:||..:.|      :..|...|:..:...| .||:::...:.|      .||...||.
  Fly     7 TLLSCLLVLANCKIQKQIPTNSWRDMLFGSKWLTPAP-RWRESKFLPIFALVPIGPGSCSAPSGE 70

  Fly    58 TGTCLTRFKCMRQSGTVNGYC-GTYGVCCETNLQVGSSTRQKRTIIKNP-------GVLSSDLNT 114
            .|.|:....|:.::|...|.| |.|||||......|...|:..|...||       |..|..:  
  Fly    71 QGNCIPSKDCVLRNGIPAGPCGGGYGVCCIFLQTCGGIIRENSTYFVNPNHPDVYDGTGSCQV-- 133

  Fly   115 YTIEAFSSNVQQLRIDFEQFVMQQPTDVDGVLECQDYFEAGGF---KLCGVNDGQHLYLPFNAAA 176
             |::....::.|||:|.:.|.:..|...:.:........:||.   .:||.:.|.|:|:  :|..
  Fly   134 -TVQKLHPDICQLRLDLDMFSIAPPEAANHLCNQDQLLISGGSPTPTICGSSTGDHMYI--DAGL 195

  Fly   177 GVDQVTLTFVVTSRGTAPVWRLIVTQLEGPPANSRRRSSTSTGLGTSTNSLQDLRDIFASHHADY 241
            |.....:..|:||.....:||:.|||:                                  |...
  Fly   196 GQSNPIVLSVITSGSFPRLWRIRVTQI----------------------------------HCGS 226

  Fly   242 ELLAPPGCQQYYTDLSGTIRSFNFQTSVTSNYMPDLSYNICIRSATSASMIEYS---------FS 297
            ...|..||.||||.:||.:||||:.| |....:.:..|:||||:..:...|:|:         ..
  Fly   227 ISRADQGCLQYYTAISGRVRSFNYNT-VGGRQLSNQDYSICIRNERNFCGIQYNACPDLENNRSR 290

  Fly   298 KFSMSVQSDS--------GEGYDEFCHATVHTTGRQEDYLMIPQSILAKNMAYQPTYYCGTNDNL 354
            .|:::..|::        |.|...      :..|...|:|:|.....|..:...|    |..|.:
  Fly   291 SFTLTGNSNNPVATMVGGGGGMPP------NLNGCTSDWLLIGCIRSADRIPPLP----GCEDRV 345

  Fly   355 --------------LVYAS-PPYMMHFSSDDLTLNRDVET-GFSMTYRQR 388
                          .|.:| .|:.::|.:|.:....|::. ||.:.|.|:
  Fly   346 CGGTFSAEAGMLAKTVQSSVRPFRLYFHTDGVEAPNDIDNRGFCLDYVQQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17047NP_001286385.1 None
CG13310NP_648257.1 CUB 105..191 CDD:294042 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.