DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17047 and CG17264

DIOPT Version :9

Sequence 1:NP_001286385.1 Gene:CG17047 / 36478 FlyBaseID:FBgn0033827 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001259978.1 Gene:CG17264 / 33511 FlyBaseID:FBgn0031490 Length:704 Species:Drosophila melanogaster


Alignment Length:449 Identity:110/449 - (24%)
Similarity:155/449 - (34%) Gaps:140/449 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLFPLGLL-AIAQAQTLNDTA----------------SGAL---AVAQE---------PG----- 36
            |:|.:||. |::.....|:||                .|||   :.|.|         ||     
  Fly    67 LIFQVGLAPAVSARSPANETAWPPMRHYDIWDDHLGEPGALEEDSFADEVNFRLQTGTPGELDIE 131

  Fly    37 --MWRQARRRSVLADS----------------CVTNSG-TTGTCLTRFKCMRQSGTVNGYCGT-Y 81
              :...:.|.|..|::                |:::.. ..|.||..::|.::.|...|.|.. :
  Fly   132 MSLQEISDRNSSQANNRQGKVIHLFPVPVDGYCMSSDNRRIGNCLNAYECRQKDGQARGECAMGF 196

  Fly    82 GVCCETNLQVGSSTRQKRTIIKNPGVLSSDLNTYT-----IEAFSSNVQQLRIDFEQFVMQQPTD 141
            ||||.......::.....|.|.:|...|...:.:|     ::..|..:.|:||||..|.:.||..
  Fly   197 GVCCVFLASCNTTITNNVTYIVSPEFPSFMPSNFTGCSLRVKMMSDEISQVRIDFHHFTLGQPNR 261

  Fly   142 VDGVLECQDYFEAGG-----FKLCGVNDGQHLYLPFNAAAGVDQVTLTFVVTSRGTAPVWRLIVT 201
            ..||.| .|.|..||     |.|||.|.|||||......|...|.||                  
  Fly   262 RTGVCE-GDIFSIGGGPGGNFSLCGQNSGQHLYYDVGTRASPRQSTL------------------ 307

  Fly   202 QLEGPPANSRRRSSTSTGLGTSTNSLQDLRDIFASHHA---------------DYELLAPPGCQQ 251
                  ..|.|....|||...||.:.....||..|..:               .:...||.||.|
  Fly   308 ------YGSLRPVDASTGPSNSTPTGDRFIDISLSLSSRLLPLRIWEMSVVQIPFSQRAPAGCLQ 366

  Fly   252 YYTDLSGTIRSFNFQTSVTSNYMPDLSYNICIRSATSASMIEY------SF-------------- 296
            |:|...|.:::|||  :....::.:.:|.||:|.......|.|      ||              
  Fly   367 YHTGTEGIMQTFNF--AENGRHLANQNYRICVRQELDMCSIMYQPCDEQSFRIGGGGRMASRGGG 429

  Fly   297 ---------SKFSMSVQSD-SGEGYDEFCHATVHTTGRQEDYLMIPQSILAKNMAYQPT 345
                     :......||| :|.......:|.|.||......||   .:|| |||...|
  Fly   430 TSEAAATTATSSPAPAQSDAAGATATTLGNAAVTTTAPTSSTLM---QMLA-NMANSTT 484



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.