DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4734 and CG13313

DIOPT Version :9

Sequence 1:NP_610864.1 Gene:CG4734 / 36477 FlyBaseID:FBgn0033826 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_648267.1 Gene:CG13313 / 39022 FlyBaseID:FBgn0035941 Length:415 Species:Drosophila melanogaster


Alignment Length:374 Identity:87/374 - (23%)
Similarity:138/374 - (36%) Gaps:107/374 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CIASALLL-----------LAVVAATQAASVATP--------TCGGTTSSKNINLVNPTNPPRV- 48
            |:.:.|||           .:.|||...:|:...        |||.:||..|....|...|... 
  Fly    86 CVGNNLLLGTCVINGECTDNSGVAAGSCSSITAQAICCIYQRTCGASTSYNNTYFYNSNYPAPYG 150

  Fly    49 ----CEYHIKATSKYVCQLRIDW-AMTLAQPTLETDDSGLTYAECTRDYFEVDG-----LKLCGT 103
                |...:......:||||:|: :::||.|:.:        ..|:.|...:.|     ..:||.
  Fly   151 GGGRCSIVVTPPDSSICQLRVDFLSLSLAPPSGD--------GSCSTDALTITGGASQVPSICGE 207

  Fly   104 EVWQHIYVPFNATDGESLVDLVISLADRAGASGLPT--AYWDMTVTQLECPAGASVRSLDLEDDV 166
            ...||:||.||...     .:.||:|    .||..|  ..|...:..|.|.:..           
  Fly   208 NAGQHVYVDFNGVS-----PITISVA----TSGSYTFNRNWQFQIRMLGCTSAT----------- 252

  Fly   167 TIESRASTIKDGFFVAPPGCRQYFPEAKGAVKSFNYN-------DGDGIYPSRM----NYAICFR 220
                          :||.||.||:..:.|.:.|||||       :..|:..:|.    .|.||.|
  Fly   253 --------------LAPAGCLQYYMPSSGTLASFNYNSAAASALNSIGVQGTRQLANTKYGICIR 303

  Fly   221 RQTDTKTLTIR-----AYDFNVGDVVSA--STLMTDENCYSSDSTNDLDADFLMVPQATFEDTHK 278
            :.....::|..     .|.|.:.:.|.|  .||:...:..|.:.|    .|::::|..|......
  Fly   304 KAAGMCSITYSQVGSDTYSFTLTNDVGAVDPTLLATSSVQSQECT----TDYIIIPSPTQGGVAM 364

  Fly   279 HATYFCGSIKKDVVISSNNPGPLMVLFNSD-----DIYRQNEAGFAFTY 322
            .:..|||   ..:|.::.:..|.:|...:|     ||   :..||..:|
  Fly   365 PSDRFCG---LGLVSTTTSAKPFVVYTVTDGNEDMDI---SNRGFYLSY 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4734NP_610864.1 None
CG13313NP_648267.1 CUB 129..>214 CDD:294042 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.