DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4734 and CG17264

DIOPT Version :9

Sequence 1:NP_610864.1 Gene:CG4734 / 36477 FlyBaseID:FBgn0033826 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001259978.1 Gene:CG17264 / 33511 FlyBaseID:FBgn0031490 Length:704 Species:Drosophila melanogaster


Alignment Length:253 Identity:61/253 - (24%)
Similarity:97/253 - (38%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TCGGTTSSKNINLVNPTNPPRV------CEYHIKATSKYVCQLRIDW-AMTLAQPTLETDDSGLT 84
            :|..|.::....:|:|..|..:      |...:|..|..:.|:|||: ..||.||...|      
  Fly   205 SCNTTITNNVTYIVSPEFPSFMPSNFTGCSLRVKMMSDEISQVRIDFHHFTLGQPNRRT------ 263

  Fly    85 YAECTRDYFEVDG-----LKLCGTEVWQHIYV-------------------------PFNAT-DG 118
             ..|..|.|.:.|     ..|||....||:|.                         |.|:| .|
  Fly   264 -GVCEGDIFSIGGGPGGNFSLCGQNSGQHLYYDVGTRASPRQSTLYGSLRPVDASTGPSNSTPTG 327

  Fly   119 ESLVDLVISLADRAGASGLPTAYWDMTVTQLECPAGASVRSLDLEDDVTIESRASTIKDGFFVAP 183
            :..:|:.:||:.|.    ||...|:|:|.|                 :....|          ||
  Fly   328 DRFIDISLSLSSRL----LPLRIWEMSVVQ-----------------IPFSQR----------AP 361

  Fly   184 PGCRQYFPEAKGAVKSFNYNDGDGIYPSRMNYAICFRRQTDTKTLTIRAYD---FNVG 238
            .||.||....:|.:::||:.: :|.:.:..||.||.|::.|..::..:..|   |.:|
  Fly   362 AGCLQYHTGTEGIMQTFNFAE-NGRHLANQNYRICVRQELDMCSIMYQPCDEQSFRIG 418



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.