DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and Glp2r

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_783612.2 Gene:Glp2r / 93896 MGIID:2136733 Length:512 Species:Mus musculus


Alignment Length:383 Identity:102/383 - (26%)
Similarity:178/383 - (46%) Gaps:58/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITGFD---PARYAHKECGLDGEWFKHPLTNKTWS 125
            :|..|.||||.::|||.:..|..:.. ||.::..::   |.| |::.|...|.|.|...:..||.
Mouse    52 SGVFCNGTFDKYVCWPHSFPGNVSVP-CPSYLPWWNKESPGR-AYRHCLAQGTWQKQENSTDTWQ 114

  Fly   126 NYTTC-------VNLEDLNWRH----TVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHM 179
            :.:.|       .|::  ::.|    |:.|:..|||..||:::.|:|.:..:.:.|.|.|..:||
Mouse   115 DESECSENHSFKQNVD--HYHHTLLSTLQLMYTVGYSLSLISLFLALTLFLFLRKLHCTRNYIHM 177

  Fly   180 NLFASFAANNSLWLVWYLLV------MPNSE-----LLHQSPMRCVALHITLHYFLLSNYSWMLC 233
            ||||||.....:.||..::.      .|:||     .|.:....|.::.:.||||:.:|:.|:|.
Mouse   178 NLFASFILRALVVLVKDMVFYNSYSRRPDSESGWMSYLSEISASCRSVQVLLHYFVGTNHLWLLV 242

  Fly   234 EGFYLHTVLVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQN-- 296
            ||.|||.:|....:.|:||....:..||..|.:.:..:...|    ...:|..||....|.:.  
Mouse   243 EGLYLHALLEPTVLPERRLWPKYLVVGWAFPMLFVIPWIFVR----ASLENTGCWAVNENKKIWW 303

  Fly   297 ILMVPVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFR--------ATLLLVPL 353
            |:..|:.:.:.:|......|:::::.|..|..             ..||        :||||:.|
Mouse   304 IIRGPILLCVTVNFFIFLKILKLLISKFRAHQ-------------MCFRDYKYRLAKSTLLLILL 355

  Fly   354 LGL-QYILTPFRPAPKHPWENTYEIISAFT-ASFQGLCVAILFCFCNGEVIAQMKRKW 409
            :|: :::.|.|.......:.....:....| :||.|..||:.:.|.:.||.|::::.|
Mouse   356 MGVHEFLFTFFTDDQVQGFSRLIRLFIQLTLSSFHGFLVALQYGFASREVKAELRKTW 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 22/76 (29%)
7tm_4 140..390 CDD:304433 72/276 (26%)
Glp2rNP_783612.2 HRM 53..122 CDD:280888 22/70 (31%)
7tm_2 137..394 CDD:278432 71/273 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.