DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and GLP2R

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_011522379.1 Gene:GLP2R / 9340 HGNCID:4325 Length:578 Species:Homo sapiens


Alignment Length:407 Identity:111/407 - (27%)
Similarity:182/407 - (44%) Gaps:83/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AGTHCAGTFDGWLCWPDTAVGTSAYELCPDF---------------------ITGF------DPA 101
            :|..|.||||.::|||.::.|..:.. ||.:                     |:|:      :.:
Human    92 SGIFCNGTFDQYVCWPHSSPGNVSVP-CPSYLPWWSEDHQQIQGQLKLFSGKISGYKLQAKQESS 155

  Fly   102 RYAHKECGLDGEWFKHPLTNKT--WSNYTTC-------VNLEDLNWRHTVNLISEVGYGTSLLAI 157
            ..|::.|...|.|  ..:.|.|  |.:.:.|       .|::......|:.|:..|||..||:::
Human   156 GRAYRHCLAQGTW--QTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQLMYTVGYSFSLISL 218

  Fly   158 LLSLAILGYFKSLKCARITLHMNLFASFAANNSLWLVWYLLV------MPNSE-----LLHQSPM 211
            .|:|.:|.:.:.|.|.|..:||||||||.......||..::.      .|::|     .|.:...
Human   219 FLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMST 283

  Fly   212 RCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARG 276
            .|.::.:.||||:.:||.|:|.||.||||:|....:.|:||....:..||..|.:.:..:..|| 
Human   284 SCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFAR- 347

  Fly   277 LGGTPEDNRHCWMNQTNYQN--ILMVPVCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRT 339
               ...:|..||....|.:.  |:..|:.:.:.:|......|:::::.||.|..           
Human   348 ---AHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLKILKLLISKLKAHQ----------- 398

  Fly   340 VLQAFR--------ATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAF----TASFQGLCVAI 392
              ..||        :||:|:||||:..||..|  ......|...::|..|    .:||.|..||:
Human   399 --MCFRDYKYRLAKSTLVLIPLLGVHEILFSF--ITDDQVEGFAKLIRLFIQLTLSSFHGFLVAL 459

  Fly   393 LFCFCNGEVIAQMKRKW 409
            .:.|.||||.|::::.|
Human   460 QYGFANGEVKAELRKYW 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 22/102 (22%)
7tm_4 140..390 CDD:304433 79/274 (29%)
GLP2RXP_011522379.1 HRM 93..187 CDD:280888 22/96 (23%)
7tm_2 200..457 CDD:278432 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.