DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and VIPR2

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_005249618.1 Gene:VIPR2 / 7434 HGNCID:12695 Length:463 Species:Homo sapiens


Alignment Length:384 Identity:115/384 - (29%)
Similarity:183/384 - (47%) Gaps:38/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CAGTFDGWLCWPDTAVGTSAYELCPDFITGF-DPARYAHKECGLDGEWFKHPLTNKTWSNYTTCV 131
            |:|.:|...||....||.:....||...:.| ..|....|.|..|| |      ::|:.::....
Human    77 CSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDG-W------SETFPDFVDAC 134

  Fly   132 NLED------LNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMNLFASFAANNS 190
            ...|      :.:...|..|..:||..||:::.....||..|:.|.|.|..:|:|||.||.....
Human   135 GYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAI 199

  Fly   191 LWLVWYLLVMPNSELLH-----QSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFISEK 250
            ..||...::..:|..||     .|.:.|....:.|.|.:::|:.|:|.||.||||:|||.....:
Human   200 SVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRR 264

  Fly   251 RLVKWLIAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQTNYQN----ILMVPVCISMFLNLL 311
            ..:.:|: .|||.|.:.|..::.||    ...::..||  .||..:    ::.:|:.||:.:|.:
Human   265 CFLAYLL-IGWGLPTVCIGAWTAAR----LYLEDTGCW--DTNDHSVPWWVIRIPILISIIVNFV 322

  Fly   312 FLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYE 376
            ...:|:|::|.||.:| .:.|:  ......:..::||||:||.|:.|::....|.   ...:.|:
Human   323 LFISIIRILLQKLTSP-DVGGN--DQSQYKRLAKSTLLLIPLFGVHYMVFAVFPI---SISSKYQ 381

  Fly   377 II-SAFTASFQGLCVAILFCFCNGEVIAQMKRKWRMMCFSNRPRTNSYTATQVSFVRCG 434
            |: .....|||||.||:|:||.|.||..::|||||..| .....:..|.....||.|.|
Human   382 ILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRC-PTPSASRDYRVCGSSFSRNG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 17/64 (27%)
7tm_4 140..390 CDD:304433 78/259 (30%)
VIPR2XP_005249618.1 HormR 77..143 CDD:214468 18/72 (25%)
7tm_2 148..396 CDD:278432 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.