DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and SCTR

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_011509923.1 Gene:SCTR / 6344 HGNCID:10608 Length:445 Species:Homo sapiens


Alignment Length:400 Identity:124/400 - (31%)
Similarity:199/400 - (49%) Gaps:58/400 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PGAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDF---ITGFDPARYAHKECGLDG--EWFKHPL 119
            ||      |.|.:|...|||.:..|......||.|   :|..:.:.:  :.|..||  |.|..| 
Human    64 PG------CEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLF--RNCTQDGWSETFPRP- 119

  Fly   120 TNKTWSNYTTCVNLEDLN--WRHT----VNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLH 178
                  |....||:.|.:  .||:    :.::..|||.:||:.:|::|.||..|:.|.|.|..:|
Human   120 ------NLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIH 178

  Fly   179 MNLFASFAANNSLWLVWYLLVMPNSELLHQSPMR--CVALHITLHYFLLSNYSWMLCEGFYLHTV 241
            |:||.||........:...::..:.::.:....|  |..:.:...|.:::||||:|.||.||||:
Human   179 MHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTL 243

  Fly   242 LVAAFISEKRLVKWLIAFGWGSPAIVIFVYSMARGL---GGTPEDNRHCWMNQTNYQN--ILMVP 301
            |..:|.||::.::..:|||||||||.:.::::||..   .|.|  :..||....|...  |:..|
Human   244 LAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCP--SLRCWDINANASIWWIIRGP 306

  Fly   302 VCISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPA 366
            |.:|:.:|.:...||:|:::.||....:........:.:.   |:||||:||.|:.||:..|.| 
Human   307 VILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLA---RSTLLLIPLFGIHYIVFAFSP- 367

  Fly   367 PKHPWENTYEIISAF---TASFQGLCVAILFCFCNGEVIAQMKRKWR-----------MMCFSNR 417
                 |:..||...|   ..|||||.||:|:||.||||..::::||:           :..|||.
Human   368 -----EDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNS 427

  Fly   418 PRTNSYTATQ 427
            .:.:....:|
Human   428 TKASHLEQSQ 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 18/71 (25%)
7tm_4 140..390 CDD:304433 85/263 (32%)
SCTRXP_011509923.1 HRM 64..126 CDD:280888 20/76 (26%)
7tm_2 139..389 CDD:278432 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.