DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and GLP1R

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_002053.3 Gene:GLP1R / 2740 HGNCID:4324 Length:463 Species:Homo sapiens


Alignment Length:408 Identity:108/408 - (26%)
Similarity:179/408 - (43%) Gaps:72/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RAACETRLNASGQLAGSGGPGAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFI--TGFDPARY 103
            |..|:..|...        |.......|..|||.:.||||...|:.....||.::  ....|..:
Human    43 RRQCQRSLTED--------PPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGH 99

  Fly   104 AHKECGLDGEWFKHPLTNKTWSNYTTCVNL---------EDLNWRHTVNLISEVGYGTSLLAILL 159
            .::.|..:|.|.:...::..|.:.:.|...         |.|.:.:   :|..|||..|..|:::
Human   100 VYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY---IIYTVGYALSFSALVI 161

  Fly   160 SLAILGYFKSLKCARITLHMNLFASF--------------------AANNSLWLVWYLLVMPNSE 204
            :.|||..|:.|.|.|..:|:||||||                    ||....|         :..
Human   162 ASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQW---------DGL 217

  Fly   205 LLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFISEKRLVKWLIAFGWGSPAIVIF 269
            |.:|..:.|..:.:.:.|.:.:||.|:|.||.||:|:|..:.:||:.:.:..::.|||.|.:.:.
Human   218 LSYQDSLSCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVV 282

  Fly   270 VYSMARGLGGTPEDNRHCWMNQT--NYQNILMVPVCISMFLNLLFLCNIVRVVL--LKLNAPASI 330
            .:.:.:.|    .::..||...:  ||..|:.:|:..::.:|.|....::.:|:  ||.|.....
Human   283 PWGIVKYL----YEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKT 343

  Fly   331 QGSCGPSRTVLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAFT----ASFQGLCVA 391
            ...|       :..::||.|:||||...::..| ...:|. ..|...|..||    .|||||.||
Human   344 DIKC-------RLAKSTLTLIPLLGTHEVIFAF-VMDEHA-RGTLRFIKLFTELSFTSFQGLMVA 399

  Fly   392 ILFCFCNGEVIAQMKRKW 409
            ||:||.|.||..:.::.|
Human   400 ILYCFVNNEVQLEFRKSW 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 17/68 (25%)
7tm_4 140..390 CDD:304433 75/277 (27%)
GLP1RNP_002053.3 HRM 60..128 CDD:280888 17/67 (25%)
7tm_2 144..398 CDD:278432 75/278 (27%)
Important for allosteric inhibitor binding. /evidence=ECO:0000269|PubMed:28514449 352..355 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.