DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and Vipr1

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_036817.1 Gene:Vipr1 / 24875 RGDID:3961 Length:459 Species:Rattus norvegicus


Alignment Length:430 Identity:126/430 - (29%)
Similarity:208/430 - (48%) Gaps:79/430 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 THCAGTFDGWLCWPDTAVGTSAYELCPDFITGFDPARYAHKECGLDGEWFKHPLTNKTWSN---- 126
            |.|:..:|...|||.|..|.:....||.....|.|         :.|.......|.:.||.    
  Rat    61 TGCSKMWDNLTCWPTTPRGQAVVLDCPLIFQLFAP---------IHGYNISRSCTEEGWSQLEPG 116

  Fly   127 -YTTCVNLED----------LNWRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMN 180
             |.....|.|          ..:.:||.....:||..||.::|:::|||..|:.|.|.|..:||:
  Rat   117 PYHIACGLNDRASS
LDEQQQTKFYNTVKTGYTIGYSLSLASLLVAMAILSLFRKLHCTRNYIHMH 181

  Fly   181 LFASFAANNSLWLVWYLLVMPNSELLH--QSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLV 243
            ||.||....:...:..:.:..:.|:.|  ::.:.|.|..:...|.:::|:.|:|.||.||:|:|.
  Rat   182 LFMSFILRATAVFIKDMALFNSGEIDHCSEASVGCKAAVVFFQYCVMANFFWLLVEGLYLYTLLA 246

  Fly   244 AAFISEKRLVKWLIAFGWGSPAIVIFVYSMAR----GLGGTPEDNRHCW---MNQTNYQNILMVP 301
            .:|.||::.....|..|||.|::.|.::::.|    ..|        ||   :|.:.:. |:..|
  Rat   247 VSFFSERKYFWGYILIGWGVPSVFITIWTVVRIYFEDFG--------CWDTIINSSLWW-IIKAP 302

  Fly   302 VCISMFLN-LLFLCNIVRVVLLKLNAPASIQGSCGP-SRTVLQAFRATLLLVPLLGLQYILTPFR 364
            :.:|:.:| :||:| |:|:::.||..|...:....| ||..    ::||||:||.|:.|::..|.
  Rat   303 ILLSILVNFVLFIC-IIRILVQKLRPPDIGKNDSSPYSRLA----KSTLLLIPLFGIHYVMFAFF 362

  Fly   365 PAP-KHPWENTYEIISAFTASFQGLCVAILFCFCNGEVIAQMKRKWR------MMCFSNRPR--- 419
            |.. |...:..:|::   ..||||..||||:||.||||.|:::||||      ::.:|::.:   
  Rat   363 PDNFKAQVKMVFELV---VGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPW 424

  Fly   420 --TNSYT-ATQVSFV-RCGPPLPGEEKVXLKDMSAKRRAS 455
              :|..| :||||.: |..|             ||:|.:|
  Rat   425 GGSNGATCSTQVSMLTRVSP-------------SARRSSS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 17/70 (24%)
7tm_4 140..390 CDD:304433 79/261 (30%)
Vipr1NP_036817.1 HormR 59..130 CDD:214468 19/77 (25%)
7tmB1_VIP-R1 140..407 CDD:320397 93/283 (33%)
TM helix 1 143..167 CDD:320397 9/23 (39%)
TM helix 2 176..197 CDD:320397 6/20 (30%)
TM helix 3 217..239 CDD:320397 6/21 (29%)
TM helix 4 258..274 CDD:320397 6/15 (40%)
TM helix 5 292..315 CDD:320397 6/23 (26%)
TM helix 6 342..364 CDD:320397 9/25 (36%)
TM helix 7 369..394 CDD:320397 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.