DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dh31-R and Fbxo46

DIOPT Version :9

Sequence 1:	NP_001260951.1	Gene:	Dh31-R / 36475	FlyBaseID:	FBgn0052843	Length:	604	Species:	Drosophila melanogaster
Sequence 2:	NP_780739.1	Gene:	Fbxo46 / 243867	MGIID:	2444918	Length:	603	Species:	Mus musculus

Alignment Length:	74	Identity:	16/74 - (21%)
Similarity:	24/74 - (32%)	Gaps:	10/74 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 GNPNATFSGSGSGSGTNVASIAESVA----------ESGPDFDALRAACETRLNASGQLAGSGGP 60
            |.|....:.:.||...::.|:||.||          :|.|.............:..|...|.|..
Mouse   152 GTPATEVTPTSSGDDVDLVSVAEMVALVEQRAALALQSYPRPSTPAPVVFVSADQGGPAKGLGSE 216

  Fly    61 GAEAGTHCA 69
            ....|..|:
Mouse   217 RRSGGGDCS 225

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dh31-R	NP_001260951.1	HRM	65..132	CDD:280888	2/5 (40%)
Dh31-R	NP_001260951.1	7tm_4	140..390	CDD:304433
Fbxo46	NP_780739.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	18..54
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..165		3/12 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	235..301
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	332..359
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	412..442
		F-box-like	473..>507	CDD:372399
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4564
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900