DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and Adcyap1r1

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001257508.1 Gene:Adcyap1r1 / 24167 RGDID:2038 Length:523 Species:Rattus norvegicus


Alignment Length:526 Identity:140/526 - (26%)
Similarity:203/526 - (38%) Gaps:138/526 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FDALRAACETRLNASGQLAG--SGGPGAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITGFD 99
            |...:|.|..|:..:..|.|  ...||      |.|.:|...||....||......||:....|:
  Rat    26 FKKEQAMCLERIQRANDLMGLNESSPG------CPGMWDNITCWKPAQVGEMVLVSCPEVFRIFN 84

  Fly   100 PARYAHKECGLDGEWFKHPL-----------------------TNKTWS----NYTTCVNLEDLN 137
            |          |..|....:                       |...||    :|......:|..
  Rat    85 P----------DQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYE 139

  Fly   138 --------WRHTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHMNLFASFAANN-SLWL 193
                    :..:|..:..|||.|||..:..::.||..|:.|.|.|..:|||||.||.... |:::
  Rat   140 PESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFI 204

  Fly   194 V-WYLLVMPNSELLHQSPMRCVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFISEKRLVKWLI 257
            . |.|....:|.....|.:.|.|:.:..||.::|||.|:..||.||.|:||..|..|:|...|..
  Rat   205 KDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYT 269

  Fly   258 AFGWGSPAIVIFVYSMARGLGGTPEDNRHCW-MN-QTNYQNILMVPVCISMFLNLLFLCNIVRVV 320
            ..|||:|.:.:.|:::.|    ...|:..|| || .|....::..||..|:.:|.:....|:.::
  Rat   270 IIGWGTPTVCVTVWAVLR----LYFDDAGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIIIL 330

  Fly   321 LLKLNAP-----------------------------ASIQGS-----------CGPSRT------ 339
            :.||.:|                             .|.|.|           |.|.|.      
  Rat   331 VQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCVQKCYCKPQRAQQHSCK 395

  Fly   340 -------VLQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYE----IISAFTASFQGLCVAIL 393
                   .|:..|:||||:||.|:.|.:..|.|      ||..:    :......||||..||:|
  Rat   396 MSELSTITLRLARSTLLLIPLFGIHYTVFAFSP------ENVSKRERLVFELGLGSFQGFVVAVL 454

  Fly   394 FCFCNGEVIAQMKRKWRMMCFSNRPRTNSYTATQVSFVRCGPPLP------GEEKVXLKDMSAKR 452
            :||.||||.|::|||||..      :.|.|..  :.|....|.|.      |.:...|...|::.
  Rat   455 YCFLNGEVQAEIKRKWRSW------KVNRYFT--MDFKHRHPSLASSGVNGGTQLSILSKSSSQL 511

  Fly   453 RASAGP 458
            |.|:.|
  Rat   512 RMSSLP 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 17/93 (18%)
7tm_4 140..390 CDD:304433 88/310 (28%)
Adcyap1r1NP_001257508.1 HRM 51..136 CDD:280888 19/100 (19%)
Important for ligand binding and specificity. /evidence=ECO:0000250 124..138 1/13 (8%)
7tm_2 149..451 CDD:278432 88/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.