DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and anmt-2

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_498334.1 Gene:anmt-2 / 175868 WormBaseID:WBGene00018340 Length:274 Species:Caenorhabditis elegans


Alignment Length:130 Identity:27/130 - (20%)
Similarity:49/130 - (37%) Gaps:43/130 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DTAVGTSAYE-LCPDFITGF-DPARYAHKECGLD------GEWFKHPLT----------NKTWSN 126
            |...|.:.|. ||      | |.|:..|....:|      .:|.:|..|          |:|...
 Worm    76 DIGAGPTVYSALC------FRDVAKRVHLSDFVDRNLDVLRKWIRHEETIDWVPTIKVINRTEGG 134

  Fly   127 YT----TCVNLED----------LNWR--HTVNLISEV-GYGTSLLAILLSL--AILGYFKSLKC 172
            .|    .|:::|:          :::.  |.::::.|: |....:|..:.:|  |...|.:..||
 Worm   135 PTPTDQVCIDVEEKARGLVKSGGIHFADVHQMDVVPELAGKKVDILVSIFTLESACRNYEEYCKC 199

  Fly   173  172
             Worm   200  199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 17/73 (23%)
7tm_4 140..390 CDD:304433 9/36 (25%)
anmt-2NP_498334.1 NNMT_PNMT_TEMT 13..273 CDD:250464 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.