DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and CRHR1

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001138618.1 Gene:CRHR1 / 1394 HGNCID:2357 Length:444 Species:Homo sapiens


Alignment Length:451 Identity:126/451 - (27%)
Similarity:199/451 - (44%) Gaps:109/451 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CETRLNASGQLAGSGGPGAEAGTHCAGTFDGWLCWPDTAVGTSAYELCPDFITG--FDPARYAHK 106
            ||: |:.:..::|.   ...|.....||     |||.:..|......||.|..|  ::.....::
Human    30 CES-LSLASNISGL---QCNASVDLIGT-----CWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYR 85

  Fly   107 ECGLDGEWFKHPLTNKTWS---NYTTCVNLEDLNWR-------HTVNLISEVGYGTSLLAILLSL 161
            ||          |.|.:|:   ||:.|  .|.||..       |...:|:.:|:..||:|:|::.
Human    86 EC----------LANGSWAARVNYSEC--QEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAF 138

  Fly   162 AIL---------------GYF--------------KSLKCARITLHMNLFASFAANNSLWLVWYL 197
            .:.               |..              :|::|.|..:|.||.::|...|:.|.|..|
Human   139 VLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLRNIIHWNLISAFILRNATWFVVQL 203

  Fly   198 LVMPNSELLHQSPMR-CVALHITLHYFLLSNYSWMLCEGFYLHTVLVAAFISEKRLVKWL-IAFG 260
            .:.|.   :|||.:. |..:....:||.::|:.||..||.||||.:|..: |..||.||: |..|
Human   204 TMSPE---VHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTY-STDRLRKWMFICIG 264

  Fly   261 WGSPAIVIFVYSMARGLGGTPEDNRHCWMNQ-----TNYQNILMVPVCISMFLNLLFLCNIVRVV 320
            ||.|..:|    :|..:|....||..||..:     |:|  |...|:.:.:.:|.:||.||||::
Human   265 WGVPFPII----VAWAIGKLYYDNEKCWFGKRPGVYTDY--IYQGPMILVLLINFIFLFNIVRIL 323

  Fly   321 LLKLNAPASIQGSCGPSRTV--LQAFRATLLLVPLLGLQYILTPFRPAPKHPWENTYEIISAFTA 383
            :.||.|..:       |.|:  .:|.:|||:|:||||:.|:|....|.........:...::|..
Human   324 MTKLRASTT-------SETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLE 381

  Fly   384 SFQGLCVAILFCFCNGEVIAQMKRKW--------------RMMCFSNRPRTNSYTATQVSF 430
            ||||..|::.:||.|.||.:.::::|              |.|.....|       |:|||
Human   382 SFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSP-------TRVSF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 18/71 (25%)
7tm_4 140..390 CDD:304433 86/287 (30%)
CRHR1NP_001138618.1 HormR 40..111 CDD:214468 23/90 (26%)
Important for peptide agonist binding 99..108 4/10 (40%)
7tm_2 116..388 CDD:278432 86/288 (30%)
Important for antagonist binding 309..319 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2715
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.