DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh31-R and Crhr1

DIOPT Version :9

Sequence 1:NP_001260951.1 Gene:Dh31-R / 36475 FlyBaseID:FBgn0052843 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_031788.1 Gene:Crhr1 / 12921 MGIID:88498 Length:415 Species:Mus musculus


Alignment Length:370 Identity:116/370 - (31%)
Similarity:185/370 - (50%) Gaps:53/370 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AGTHCAGTFD--GWLCWPDTAVGTSAYELCPDFITG--FDPARYAHKECGLDGEWFKHPLTNKTW 124
            :|..|..:.|  | .|||.:..|......||.|..|  ::.....::||          |.|.:|
Mouse    40 SGLQCNASVDLIG-TCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYREC----------LANGSW 93

  Fly   125 S---NYTTCVNLEDLNWR-------HTVNLISEVGYGTSLLAILLSLAILGYFKSLKCARITLHM 179
            :   ||:.|  .|.||..       |...:|:.:|:..||:|:|::..:....:|::|.|..:|.
Mouse    94 AARVNYSEC--QEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHW 156

  Fly   180 NLFASFAANNSLWLVWYLLVMPNSELLHQSPMR-CVALHITLHYFLLSNYSWMLCEGFYLHTVLV 243
            ||.::|...|:.|.|..|.|.|.   :|||.:. |..:....:||.::|:.||..||.||||.:|
Mouse   157 NLISAFILRNATWFVVQLTVSPE---VHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIV 218

  Fly   244 AAFISEKRLVKWL-IAFGWGSPAIVIFVYSMARGLGGTPEDNRHCWMNQ-----TNYQNILMVPV 302
            ..: |..||.||: :..|||.|..:|    :|..:|....||..||..:     |:|  |...|:
Mouse   219 LTY-STDRLRKWMFVCIGWGVPFPII----VAWAIGKLYYDNEKCWFGKRPGVYTDY--IYQGPM 276

  Fly   303 CISMFLNLLFLCNIVRVVLLKLNAPASIQGSCGPSRTV--LQAFRATLLLVPLLGLQYILTPFRP 365
            .:.:.:|.:||.||||:::.||.|..:       |.|:  .:|.:|||:|:||||:.|:|....|
Mouse   277 ILVLLINFIFLFNIVRILMTKLRASTT-------SETIQYRKAVKATLVLLPLLGITYMLFFVNP 334

  Fly   366 APKHPWENTYEIISAFTASFQGLCVAILFCFCNGEVIAQMKRKWR 410
            .........:...::|..||||..|::.:||.|.||.:.::::||
Mouse   335 GEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh31-RNP_001260951.1 HRM 65..132 CDD:280888 20/73 (27%)
7tm_4 140..390 CDD:304433 85/258 (33%)
Crhr1NP_031788.1 HormR 40..111 CDD:214468 23/83 (28%)
7tm_2 116..359 CDD:278432 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2715
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.