DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and SLC9A3R1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_004243.1 Gene:SLC9A3R1 / 9368 HGNCID:11075 Length:358 Species:Homo sapiens


Alignment Length:350 Identity:76/350 - (21%)
Similarity:127/350 - (36%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESKSKAPIIKVSCGIGDTDGYPAFDVDSDAYATKDDSRWGFLITG-----GAEFHMPLTVFQVTP 72
            ::.:.||:.::.|.....:||                  ||.:.|     |....:      |.|
Human     4 DAAAGAPLPRLCCLEKGPNGY------------------GFHLHGEKGKLGQYIRL------VEP 44

  Fly    73 NGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQF--EAGEE 135
            ...|:|||:..||.::|:|.|:..:.|..|...:|.:....:..|:.:.|.|:.:.:.  :..||
Human    45 GSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREE 109

  Fly   136 KSIVMRVP-KPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMSESE-- 197
            .......| :..||.:..::.:..|....|..:......|:...|| |:......:|....|:  
Human   110 LLRAQEAPGQAEPPAAAEVQGAGNENEPREADKSHPEQRELRPRLC-TMKKGPSGYGFNLHSDKS 173

  Fly   198 --------VDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDS------DEEDLVLVREED 248
                    ||.|...|......:....:.:.:..|   |:|.||..|      ||..|::|..|.
Human   174 KPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCME---GKQHGDVVSAIRAGGDETKLLVVDRET 235

  Fly   249 AE----------------DVDVP--KGAKQSKLLKDVTPESDYASEANYPA--NEASDDT--ESD 291
            .|                .:.||  .|..|.:..::...|:  |.|:..||  ..||.||  |.:
Human   236 DEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEA--ALESPRPALVRSASSDTSEELN 298

  Fly   292 DEDEPGSTVYFMKLPAAAAEDTYSS 316
            .:|.|      .|..:.|...|.||
Human   299 SQDSP------PKQDSTAPSSTSSS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 19/78 (24%)
SLC9A3R1NP_004243.1 PDZ_signaling 12..91 CDD:238492 22/102 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..192 15/78 (19%)
PDZ_signaling 152..231 CDD:238492 18/82 (22%)
EBP50_C 235..358 CDD:312529 21/90 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..358 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.