DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PDLIM1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:246 Identity:52/246 - (21%)
Similarity:97/246 - (39%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|..||.:.:|||...|..|.:.:||:|..|:.|:.|.:|..:|..:|......:.
Human    14 WGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKGCTDNLT 78

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAI--AEIPKI 178
            ..:...|.                 :|..||....|  :....:|.|....:::..|  |.....
Human    79 LTVARSEH-----------------KVWSPLVTEEG--KRHPYKMNLASEPQEVLHIGSAHNRSA 124

  Fly   179 LCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFE-LRNGEQAGDTDSD----- 237
            :..|.:..|....|:..::.: :..|   .|.....|...:||:.: ..:|.:|.....|     
Human   125 MPFTASPASSTTARVITNQYN-NPAG---LYSSENISNFNNALESKTAASGVEANSRPLDHAQPP 185

  Fly   238 -------EEDLVLVREEDAEDVDVPKGAKQSKLLKDVTPESDYASEANYPA 281
                   |.::..:.:|..|..:.||.:....:|:::. ||:...:.|.|:
Human   186 SSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEIL-ESEEKGDPNKPS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 22/67 (33%)
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492 22/67 (33%)
DUF4749 138..230 CDD:318205 17/96 (18%)
LIM_CLP36 260..311 CDD:188832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.