DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and MPDZ

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001362342.1 Gene:MPDZ / 8777 HGNCID:7208 Length:2103 Species:Homo sapiens


Alignment Length:351 Identity:74/351 - (21%)
Similarity:115/351 - (32%) Gaps:118/351 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LTVFQVTPNGLADKAGIRL-GDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMG 128
            :.:..:.|.|:|:|.|..| ||.::.:|:.:....:|.:|.|.:...|.               |
Human   728 IIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPS---------------G 777

  Fly   129 QFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRM 193
            ....|        |.||||                                              
Human   778 TVRIG--------VAKPLP---------------------------------------------- 788

  Fly   194 SESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSD--EEDLVLVREEDAEDVDVPK 256
                     :..||.||..|    ||:..:...:.|:||..|..  ..||.||...||:.||   
Human   789 ---------LSPEEGYVSAK----EDSFLYPPHSCEEAGLADKPLFRADLALVGTNDADLVD--- 837

  Fly   257 GAKQSKLLKDVTPESDYASEANYPANEASDDTESDDEDEPGSTV-----YFMKLPAAAAEDTYSS 316
                     :.|.||.|:     |.|::...|::......||:.     |...||::..:|...:
Human   838 ---------ESTFESPYS-----PENDSIYSTQASILSLHGSSCGDGLNYGSSLPSSPPKDVIEN 888

  Fly   317 TEDE--DDSDFLNTTYTWNL-----RNVPKLRINDAEAEGELTLGH--QAREVPQQEQPQEKQPC 372
            :.|.  |....|...||.||     .|.|.:.|:...|.| .|:..  .|..:.||.:.:.....
Human   889 SCDPVLDLHMSLEELYTQNLLQRQDENTPSVDISMGPASG-FTINDYTPANAIEQQYECENTIVW 952

  Fly   373 LEPE-PPKVRPATPTPKAPPQESAEG 397
            .|.. |.:|..:...|...|..:.:|
Human   953 TESHLPSEVISSAELPSVLPDSAGKG 978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 13/54 (24%)
MPDZNP_001362342.1 PDZ_signaling 2019..2102 CDD:238492
L27_2 6..63 CDD:312549
PDZ_signaling 139..221 CDD:238492
PDZ_signaling 257..334 CDD:238492
PDZ 374..463 CDD:214570
PDZ_signaling 560..629 CDD:238492
PDZ_signaling 698..784 CDD:238492 15/78 (19%)
PDZ_signaling 1006..1076 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1121..1140
PDZ_signaling 1149..1240 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1278..1324
PDZ 1347..1433 CDD:214570
PDZ_signaling 1514..1593 CDD:238492
MPDZ_u10 1595..1659 CDD:374710
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1600..1645
PDZ 1660..1744 CDD:214570
PDZ_signaling 1758..1836 CDD:238492
PDZ_signaling 1893..1978 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.