DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PDZD7

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001182192.1 Gene:PDZD7 / 79955 HGNCID:26257 Length:1033 Species:Homo sapiens


Alignment Length:497 Identity:104/497 - (20%)
Similarity:163/497 - (32%) Gaps:173/497 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VDSDAYATKDDS--------------RWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIIL 88
            ::|...|..|:|              |.||.:.||:|..:.:.|.:|.....|::||:.:||.|.
Human    70 INSPIEANSDESDIIHSVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGSSAERAGLCVGDKIT 134

  Fly    89 EINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRI 153
            |:|.......|:..| .|:.::..::|.::|.|.                  |||        .|
Human   135 EVNGLSLESTTMGSA-VKVLTSSSRLHMMVRRMG------------------RVP--------GI 172

  Fly   154 RASSIEMRLLE-MQRKLSAIAEIPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYD 217
            :.|..:...:: :.|:|                |.:..|........||.|   ...|....:.|
Human   173 KFSKEKTTWVDVVNRRL----------------VVEKCGSTPSDTSSEDGV---RRIVHLYTTSD 218

  Fly   218 EDALDFELRNGEQAG---------------DTDSDEEDLVL----VREED---AEDVDVPKGAKQ 260
            :..|.|.:|.|::.|               :......|.||    ||.:|   ::.|:|.||...
Human   219 DFCLGFNIRGGKEFGLGIYVSKVDHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKGQTH 283

  Fly   261 SKL----------------------------LKDVTPESDYASEANYPANEA---SDDTESD--- 291
            ..|                            |:.::|.|:.:|..:..|:.|   |....||   
Human   284 IMLTIKETGRYPAYKEMVSEYCWLDRLSNGVLQQLSPASESSSSVSSCASSAPYSSGSLPSDRMD 348

  Fly   292 ---DEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTW-NLRNVPKLRINDAEAEGELT 352
               .::||||     :.|.....||...||    .|......|| ::|....||.....::|.  
Human   349 ICLGQEEPGS-----RGPGWGRADTAMQTE----PDAGGRVETWCSVRPTVILRDTAIRSDGP-- 402

  Fly   353 LGHQAREVPQQEQPQEKQPCL----EPEPP------------------KVRPATPTPKAPPQESA 395
              |..|.:........|...|    .|.||                  |.:..:|..|...|.|.
Human   403 --HPGRRLDSALSESPKTALLLALSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSK 465

  Fly   396 -------EGQTQKLLFR--------LD--KLERSWPWADREK 420
                   :|..|..|.|        ||  .|.:::|..|.||
Human   466 TLMNLFFKGGRQGRLARDGRREAWTLDSGSLAKTYPRLDIEK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 22/87 (25%)
PDZD7NP_001182192.1 PDZ_signaling 84..164 CDD:238492 20/80 (25%)
PDZ_signaling 209..289 CDD:238492 18/79 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..380 16/65 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..464 4/19 (21%)
HN_PDZD7_like 554..630 CDD:259824
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 754..864
PDZ_signaling 860..948 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 943..1033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.