DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Dlg5

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_017171686.1 Gene:Dlg5 / 71228 MGIID:1918478 Length:1931 Species:Mus musculus


Alignment Length:282 Identity:62/282 - (21%)
Similarity:108/282 - (38%) Gaps:74/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SVPESKSKAP-----IIKVS--------CGIGDTDGYPAFDVDSDAYATKDDSRWGFLITGGAEF 61
            ||.::..|.|     .||.|        || |:..|....:|:.|:.|...|.    |:.|..  
Mouse  1502 SVGDTTKKTPDPRIVFIKKSQLDLGVHLCG-GNLHGVFVAEVEDDSPAKGPDG----LVPGDL-- 1559

  Fly    62 HMPLTVFQVTPNGLADKAGIRLGDIILE-INEEDASQLTLSQAHE---KINSTPKK---IHFLLR 119
                    :...|..|.....:.|:.:| :..:|:.:|.:...||   ::...|..   |..|..
Mouse  1560 --------ILEYGSLDMRSRTVEDVYVEMLKPKDSLRLKVQYRHEEFTRVKGLPGDSFYIRALYD 1616

  Fly   120 NMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLA 184
            .:.|.:|    |...:|..::.|...||.   .:..|.:..:|.|..:|:.. .:||     :..
Mouse  1617 RLAEVEP----ELSFKKDDILYVDDTLPQ---GVFGSWMAWQLDENAQKIQR-GQIP-----SKY 1668

  Fly   185 TVSQNFG-RMSESEVDEDDVGE------EEAYVQRKFSYDEDALDFELRNGEQAG------DTDS 236
            .:.|.|. |:|.|||.:|:..:      ..::.:||..:.        |:|.:.|      ||.|
Mouse  1669 VMDQEFSRRLSMSEVKDDNTAKTLSAAARRSFFRRKHKHK--------RSGSKDGKDLLALDTFS 1725

  Fly   237 DE-----EDLVLVREEDAEDVD 253
            ::     ||.|.:..:..:.||
Mouse  1726 NDSIPLFEDSVSLAYQRVQKVD 1747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 14/80 (18%)
Dlg5XP_017171686.1 Takusan 129..213 CDD:368141
Smc <141..564 CDD:224117
PDZ_signaling 625..712 CDD:238492
PDZ_signaling <741..800 CDD:238492
PDZ 1357..1439 CDD:214570
dbPDZ_assoc 1437..1512 CDD:374667 3/9 (33%)
PDZ 1513..1594 CDD:214570 19/95 (20%)
SH3_DLG5 1610..1672 CDD:212794 15/74 (20%)
GuKc 1744..1920 CDD:214504 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.