DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdzk1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:411 Identity:80/411 - (19%)
Similarity:143/411 - (34%) Gaps:127/411 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PESKSKAPIIKVSCGIGDTDGYPAFDVDSDAYATKDDSRWGF-LITGGAEFHMPLTVFQVTPNGL 75
            |....|.|.:.::.|: :|...|..     .|..|:.:.:|| |.|...:..:.||  .:||.|:
  Rat   112 PALNEKKPDLGMNGGV-ETCAQPRL-----CYLVKEGNSFGFSLKTIQGKKGVFLT--DITPQGV 168

  Fly    76 ADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHFLL-------RNMEEDDPMGQ---- 129
            |.|||:...|.::|:|.|:....:..:..||:..:..:|.|||       .:.|:..|..:    
  Rat   169 AMKAGVLADDHLIEVNGENVENASHEEVVEKVTKSGSRIMFLLVDKETARCHSEQKTPFKRETAS 233

  Fly   130 -----------------------FEAG-EEKSIVMRVPKPLPPPSG----------RIRASSIEM 160
                                   ..|| |:|..:::..:|..|...          .:...|:|.
  Rat   234 LKLLPHQPRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGESVEA 298

  Fly   161 ----RLLEMQR----------------KLSAIAEI-PKILCSTLATVSQNF--GRMSES------ 196
                .::||.|                ::.::|.. |.:.|.     ||..  |.:.|:      
  Rat   299 LDHDSVVEMIRNGGDQTTLLVLDKEADRIYSLARFSPLLYCQ-----SQELPNGSVKEAPAPISA 358

  Fly   197 ------EVDEDDVGEEEAYVQRKFSYDEDALDFEL-----------RNGEQAGDTDS---DEEDL 241
                  ....:|||:.:..:.|... ::|:..|.|           :..:|.|..|.   :.||:
  Rat   359 PLEAPGSATTEDVGDHKPKLCRLIK-EDDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLENEDI 422

  Fly   242 VL-VREEDAEDVDVPKGAKQSK-------LLKDVTPESDYASEANYPANEASDDTESDDEDEPGS 298
            :: |..|:.:|....:..::.|       ||........|......|...:..|......||.|.
  Rat   423 IIEVNGENVQDEPYDRVVERIKSSGEHVTLLVCGKVAYSYFQAKKIPILSSLADPLVAGPDEKGE 487

  Fly   299 TVYFMKLPAAAAEDTYSSTED 319
            |.:          |:..||:|
  Rat   488 TEH----------DSAESTKD 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 24/81 (30%)
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570 25/86 (29%)
PDZ_signaling 242..320 CDD:238492 11/77 (14%)
PDZ 375..455 CDD:214570 15/80 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.