DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and PDLIM2

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_067643.3 Gene:PDLIM2 / 64236 HGNCID:13992 Length:602 Species:Homo sapiens


Alignment Length:287 Identity:67/287 - (23%)
Similarity:104/287 - (36%) Gaps:76/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.||||.:||.|:.|.:|...|.|..|.:|.||||:.||.|.|..:..::|..||..:|..:.
Human   263 WGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQSPSPLR 327

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILC 180
            ..|...:...| ||....                      ||:|:.....|..:....|....|.
Human   328 LQLDRSQATSP-GQTNGD----------------------SSLEVLATRFQGSVRTYTESQSSLR 369

  Fly   181 STLATVSQNFGRMSE--SEVDEDDVGEEEAYVQRKFSY--------DEDALDFELRNGE------ 229
            |:.::.:....|...  |..........||.:.|.|..        ..|.|.:..|.|.      
Human   370 SSYSSPTSLSPRAGSPFSPPPSSSSLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQAGLG 434

  Fly   230 QAGDT------------------DSDEEDLVL--------VREEDAEDVDVPKGAKQSKLLKDV- 267
            :|||:                  ||:...|:|        :.:|:.|....|:.:...:||::. 
Human   435 RAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSSSFRLLQEAL 499

  Fly   268 -------TP---ESDYASEANYPANEA 284
                   ||   .|..:.:::.||:.|
Human   500 EAEERGGTPAFLPSSLSPQSSLPASRA 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 28/67 (42%)
PDLIM2NP_067643.3 PDZ_signaling 259..330 CDD:238492 28/66 (42%)
DUF4749 <462..505 CDD:292558 7/42 (17%)
LIM_Mystique 536..588 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10683
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003437
OrthoInspector 1 1.000 - - otm41321
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R15300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.