DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdlim7

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001025639.1 Gene:pdlim7 / 595027 XenbaseID:XB-GENE-5860425 Length:191 Species:Xenopus tropicalis


Alignment Length:113 Identity:30/113 - (26%)
Similarity:59/113 - (52%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|:|||::.::||.|.|:.||:.:||.:|:|..:..:.:|..:|..||.::..|:.
 Frog    14 WGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKLG 78

  Fly   116 FLL----------RNMEEDDPMGQFEAGEEKSIVMRVPKPL----PPP 149
            .:|          :.:...:..|:.......:.:.::.:|.    |||
 Frog    79 LVLSRFAVGVNQAKGVHTPESQGRKYNFAPSTALNKIARPFGTGTPPP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 25/77 (32%)
pdlim7NP_001025639.1 PDZ_signaling 3..81 CDD:238492 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10396
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5637
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.