DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_067605.1 Gene:Slc9a3r1 / 59114 RGDID:708538 Length:356 Species:Rattus norvegicus


Alignment Length:280 Identity:61/280 - (21%)
Similarity:108/280 - (38%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEA-- 132
            |.|...|:|:|:..||.::|:|.|:..:.|..|...:|.:....:..|:.:.|.|:.:.:...  
  Rat    42 VEPGSPAEKSGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLKKLGVPI 106

  Fly   133 ------GEEKSIVMRVPKPLPPPSG--------RIRASSIEMRLLEMQRKLSAIAEIPKILCSTL 183
                  .:|||      :...||:.        :..|....:...|::.:|..:.:.|......|
  Rat   107 REELLRAQEKS------EHTEPPAAADTKKAGDQNEAEKSHLERCELRPRLCTMKKGPNGYGFNL 165

  Fly   184 ATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDS------DEEDLV 242
            .:.....|:...: ||.|...|......:....:.:.:..|   |:|.||..|      ||..|:
  Rat   166 HSDKSKPGQFIRA-VDPDSPAEASGLRAQDRIVEVNGVCME---GKQHGDVVSAIKAGGDEAKLL 226

  Fly   243 LVREEDAE--------------DVDVPKGAKQSKLLKDVTPES--DYASEANYP--ANEASDDTE 289
            :|.:|..|              |..:|:.....::.|:.:.|:  :.|||:..|  |..||.||.
  Rat   227 VVDKETDEFFKKCRVTPSQEHLDGPLPEPFSNGEIQKENSREALVEPASESPRPALARSASSDTS 291

  Fly   290 SD----------DEDEPGST 299
            .:          |..||.||
  Rat   292 EELNAQDSPKRHDSTEPSST 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 14/48 (29%)
Slc9a3r1NP_067605.1 PDZ_signaling 12..91 CDD:238492 14/48 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142 6/34 (18%)
PDZ_signaling 149..228 CDD:238492 17/82 (21%)
EBP50_C 232..356 CDD:286142 19/80 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..356 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.