Sequence 1: | NP_001137648.1 | Gene: | CG42319 / 36473 | FlyBaseID: | FBgn0259219 | Length: | 452 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065132.1 | Gene: | GOPC / 57120 | HGNCID: | 17643 | Length: | 462 | Species: | Homo sapiens |
Alignment Length: | 209 | Identity: | 44/209 - (21%) |
---|---|---|---|
Similarity: | 87/209 - (41%) | Gaps: | 46/209 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SVPESKSKAPIIKVSCGIGDTDGYPAFDVDSDAYATKDDSRWGFLITGGAEFHMPLTVFQVTPNG 74
Fly 75 LADK-AGIRLGDIILEIN-------EEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQF- 130
Fly 131 -EAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMS 194
Fly 195 ESEVDE-----DDV 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42319 | NP_001137648.1 | PDZ_signaling | 45..119 | CDD:238492 | 20/81 (25%) |
GOPC | NP_065132.1 | bZIP_2 | <166..199 | CDD:285017 | |
PDZ_signaling | 286..368 | CDD:238492 | 25/102 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 426..449 | 4/31 (13%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |