DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdlim4

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001036161.1 Gene:pdlim4 / 569404 ZFINID:ZDB-GENE-070308-5 Length:349 Species:Danio rerio


Alignment Length:245 Identity:58/245 - (23%)
Similarity:92/245 - (37%) Gaps:47/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINS-TPK 112
            |.|||.:.||.:|..|||:.::||...|.::.:..||.||.||.|....:|..:|..:|.: |.:
Zfish    11 SPWGFRLVGGRDFSTPLTISRITPASKAAQSNLSPGDTILAINGESTESMTHMEAQNRIKACTDQ 75

  Fly   113 KIHFLLRNMEEDDPMGQFEAG--------EEKSIVMR-----------VPKPLPPPSGRIRASSI 158
            .:..:.|:.:...|.|..|..        |..|...|           .|.|..|.:|.:..::.
Zfish    76 LVLAICRSGKAWSPTGMEELKTSPFSPTLESDSQTFRPISSGYSPTPKSPSPKSPITGAVPYNNG 140

  Fly   159 EMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMS-ESEVDEDDVGEEEAYVQRKFSYDEDALD 222
            ..|               .:..:.....|.|.|..: ..::....:|...:     ||.:.....
Zfish   141 GSR---------------PVYNNPAGLYSHNNGNGALPKQMSGLSLGSPHS-----FSPEPPVNS 185

  Fly   223 FELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKDVTPESD 272
            ...|||   .||.||...::|..|   |.|..||.:...|.|:.:....|
Zfish   186 SGNRNG---FDTQSDVYRMLLDYE---EPVSAPKQSGSFKYLQGILEAED 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 24/70 (34%)
pdlim4NP_001036161.1 PDZ_signaling 3..78 CDD:238492 24/66 (36%)
DUF4749 146..233 CDD:292558 22/95 (23%)
LIM_RIL 274..326 CDD:188835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.