DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdzd3b

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001124259.1 Gene:pdzd3b / 566852 ZFINID:ZDB-GENE-081022-151 Length:524 Species:Danio rerio


Alignment Length:346 Identity:71/346 - (20%)
Similarity:115/346 - (33%) Gaps:101/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SKSKAPIIKVSCGIGDTDGYP------AFDVDSDAYATKDDSRWGFLI---TGGA--EFHMPLTV 67
            ::.|.||:.   .:.|.:..|      ...:..|.|        |||:   .|||  ..||   |
Zfish   236 ARRKMPILP---AMADAENMPYRPQRLHLVMGPDGY--------GFLLRQEKGGAGRTVHM---V 286

  Fly    68 FQVTPNGLADKAGIRLGDIILEINEEDASQLT-------LSQAHEKI---NSTPKKIHFLLR-NM 121
            .:|.....|:..|::.|:::||:|.|....|:       :.|:.:::   ..||:...|..: .:
Zfish   287 REVDKGSPAELGGVKEGEMLLEVNGESTDPLSHKDVVSNIRQSGQQVTLTTMTPQGYDFYTKLGL 351

  Fly   122 EE-----DDPMGQFEAGEEKSIVMRVPKPLPPP---------SGRIRASSIEMRLLEMQRKLSAI 172
            ..     |.|....|..:|..:   .|||..||         :..:|...:|.........|..:
Zfish   352 SPLLFCVDVPSALPEVKKEIPV---TPKPAVPPVEPQEEVQINPNVRRCILERSSAGFGFHLGCV 413

  Fly   173 AEIPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSD 237
            .:.|....|.:|..|..    ..|.:.:.||..|.                   ||:.       
Zfish   414 QQKPGTFISQVAAGSPG----QSSGLFQGDVVVEV-------------------NGQN------- 448

  Fly   238 EEDLVLVREEDAEDV--DVPKGAKQSKLLKDVTPESDYASEANYPANEASDDTESDDEDEPGSTV 300
                  |.:|..|||  .|.:|.:...||.......|:..:...|......:|.|:.|:...|  
Zfish   449 ------VEKESLEDVIMHVKRGGETLSLLVVDQKGYDWLKQNGKPVTLNKLETISEVEESVSS-- 505

  Fly   301 YFMKLPAAAAEDTYSSTEDED 321
                    :||.....|.|.|
Zfish   506 --------SAETARVKTGDSD 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 22/88 (25%)
pdzd3bNP_001124259.1 PDZ_signaling 44..118 CDD:238492
PDZ 148..227 CDD:214570
PDZ_signaling 264..336 CDD:238492 21/82 (26%)
PDZ 393..473 CDD:214570 22/115 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.