DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Pdlim5

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006501801.1 Gene:Pdlim5 / 56376 MGIID:1927489 Length:734 Species:Mus musculus


Alignment Length:131 Identity:37/131 - (28%)
Similarity:67/131 - (51%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|:||||:..:...|.|.:|.:|:||::|.|:...|..:|..:|..||.:....::
Mouse    14 WGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLN 78

  Fly   116 FLLRNME---EDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIPK 177
            ..|:...   :.:|: ..:.||.|.:|.  |.|:..|:.....|:..|...:..|...:::. ||
Mouse    79 MTLQRASAAAKSEPV-SVQKGEPKEVVK--PVPITSPAVSKVTSTTNMAYNKAPRPFGSVSS-PK 139

  Fly   178 I 178
            :
Mouse   140 V 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 23/67 (34%)
Pdlim5XP_006501801.1 PDZ_signaling 10..82 CDD:238492 23/67 (34%)
PHA03307 150..>540 CDD:223039
DUF4749 214..315 CDD:374237
LIM1_ENH 558..609 CDD:188837
LIM2_ENH 617..668 CDD:188841
LIM3_ENH 676..730 CDD:188843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.