DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and grid2ipb

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_009304908.1 Gene:grid2ipb / 559717 ZFINID:ZDB-GENE-040724-161 Length:1383 Species:Danio rerio


Alignment Length:426 Identity:83/426 - (19%)
Similarity:149/426 - (34%) Gaps:93/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            :||.:.|    |.|:.:..|.|...|:..|::.||.||.:|..|....    :|||:.|..:...
Zfish   346 FGFTLRG----HAPVWIDSVMPGSPAEACGLKTGDRILFLNGLDMRNC----SHEKVVSMLQGSG 402

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPK-------------PLPPPSGRIRASSIEMR---LLE 164
            .:...:.|:.|:...::..|.......|:             .:.|||.|:...:...:   ||.
Zfish   403 AMPSLVVEEGPVDYPQSDSEPEETPSAPRSRSPALSSLQWVAEILPPSIRVHGRTFSQQLEHLLT 467

  Fly   165 MQRKLSAIAEIPKILCSTLATVSQNFGRMSESEVDEDDVGEEEA------YVQRKFSYDEDA--- 220
            :|.:.:        :|..|.|..|: ..:....||...|.:..|      ::.:..:|:|..   
Zfish   468 LQERYT--------ICKALETFFQH-RNVDTLIVDVFPVLDTPAKQLIWQFIYQLLTYEEQEHCK 523

  Fly   221 ------LDFELRNGEQAGDTDSDEEDLVL--------VREEDAEDVDVPKGAKQSKLLKDVTPES 271
                  |.|:....|...:|......:.:        |||..::|..:............||||.
Zfish   524 TKIARFLGFKSAEPEVGAETHRRSSSMRVSGTSHKNTVRERSSDDCIIGTHLGMGTFTDPVTPEE 588

  Fly   272 DYASE-ANYPANEASDDTESDDEDEPGSTVYFMK---------LPAAAA-----EDTYSSTEDED 321
            ....: .::|  |:.|.:...........||.:|         .|.||.     .:||:.:    
Zfish   589 RQCGDGTSFP--ESPDLSHMTGVYTELGNVYPVKSSQSLQSHSSPRAAGMGLAESNTYTQS---- 647

  Fly   322 DSDFLNTTYTWNLRNVPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQPCLEPEPPKVRPATPT 386
               |.::| ..|.::...|...|:....:.....|....|..   .:..|.:..:.|   ||:|.
Zfish   648 ---FTHST-AGNRKSGLSLTWTDSFPGPQFETYQQTVASPDS---VDSNPYVSLDSP---PASPL 702

  Fly   387 PKAPPQESAEGQTQKLLFRLDKLERSWPWADREKII 422
            |.   .|.:....::.||...:..||   .|.:|.:
Zfish   703 PS---DELSPLPQRRKLFTFSRPPRS---RDTDKFL 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 19/67 (28%)
grid2ipbXP_009304908.1 PDZ_signaling 9..69 CDD:238492
PDZ_signaling 80..156 CDD:238492
HN_L-delphilin-R1_like 183..262 CDD:259820
PDZ_signaling 335..410 CDD:238492 19/71 (27%)
HN_L-delphilin-R2_like 451..530 CDD:259821 14/87 (16%)
FH2 995..1360 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.