powered by:
Protein Alignment CG42319 and PDZD11
DIOPT Version :9
Sequence 1: | NP_001137648.1 |
Gene: | CG42319 / 36473 |
FlyBaseID: | FBgn0259219 |
Length: | 452 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016885057.1 |
Gene: | PDZD11 / 51248 |
HGNCID: | 28034 |
Length: | 172 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 22/68 - (32%) |
Similarity: | 38/68 - (55%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 GFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHF 116
||.|.||....:.:.:.:|.|:..|.:||::.||.:|.:|:.|...:..|:|.| |..|.::|..
Human 91 GFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVE-ILKTAREISM 154
Fly 117 LLR 119
.:|
Human 155 RVR 157
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.