DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Ldb3

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:XP_006252699.3 Gene:Ldb3 / 498587 RGDID:1564875 Length:771 Species:Rattus norvegicus


Alignment Length:380 Identity:72/380 - (18%)
Similarity:123/380 - (32%) Gaps:107/380 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|:||||:.::||...|.::.:..||:::.|:..:...:|..:|..||.|....:.
  Rat    58 WGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLS 122

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLP------PPSGRIRASSIEMRLLEMQRKLSAIAE 174
            ..|:..:...|:        .:....:..|||      .||            |:....|:..:.
  Rat   123 LTLQKSKRPIPI--------STTAPPIQSPLPVIPHQKDPS------------LDTNSSLATPSP 167

  Fly   175 IPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEE 239
            .|:...|...:.:..||....|...:..|.....                    |.:|.......
  Rat   168 SPEARASPGTSGTLEFGDTFSSSFSQTSVCTSHM--------------------EASGPVLPLGS 212

  Fly   240 DLVLVREEDAEDVDVPK---GAKQSKLLKDVTPESDYASE------------------------A 277
            .:.....|..:....||   |..|.:|..:  |...|::|                        .
  Rat   213 PVAKASSEGTQGSVSPKVLPGPSQPRLYNN--PIGLYSAETLREMAQMYQMSLRGKASGAGLLGG 275

  Fly   278 NYPANEASDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRI 342
            :.|..:.:.|:        .|.||      .|...|.|..|||.|.        | .|....|:.
  Rat   276 SLPVKDLAVDS--------ASPVY------QAVIKTQSKPEDEADE--------W-ARRSSNLQS 317

  Fly   343 NDAEAEGELTLGHQAREVPQQEQPQEKQPCLEPEP--------PKVRPATPTPKA 389
            .......::| |.:..:.|.:|..:.....:|..|        |.:..:.|:|.|
  Rat   318 RSFRILAQMT-GTEYMQDPDEEALRRSSTPIEHAPVCTSQATSPLLPASAPSPAA 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 21/67 (31%)
Ldb3XP_006252699.3 PDZ_signaling 50..126 CDD:238492 21/67 (31%)
DUF4749 240..341 CDD:406377 22/126 (17%)
PHA03247 <426..576 CDD:223021
LIM1_ZASP_Cypher 595..646 CDD:188838
LIM2_Enigma_like 654..705 CDD:188748
LIM3_ZASP_Cypher 713..767 CDD:188844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10378
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.