DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and CG10939

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster


Alignment Length:204 Identity:45/204 - (22%)
Similarity:79/204 - (38%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PESKSKAPIIKVSCGI---GDTDGYPAFDVDSDAYATKDDSRWGFLITGGAEFHMPLTVFQVTPN 73
            |...:..|.:..:|.|   .|.||| .|::.|:....             .:|     :.:|..:
  Fly    10 PTPPTLPPGVTKTCHIVKRPDFDGY-GFNLHSEKVKP-------------GQF-----IGKVDAD 55

  Fly    74 GLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEAGEEKSI 138
            ..|:.||::.||.|||:|.......|..|...:|.:...::..||.:::          |:...:
  Fly    56 SPAEAAGLKEGDRILEVNGVSIGSETHKQVVARIKAIANEVRLLLIDVD----------GKALEV 110

  Fly   139 VMRVPKPLPPP------SGRIRASSIEMRLLEMQRKLSAIAEIPKILC--STLATVSQNFGRMSE 195
                 ||..||      :|....:..|....||....:.|:.|..:..  |:.|:..|:...|:.
  Fly   111 -----KPASPPAAACNGNGSASQNGYEGTKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNA 170

  Fly   196 SEVDEDDVG 204
            |::|..|.|
  Fly   171 SDLDVVDRG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 15/73 (21%)
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.