DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and CG34375

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:359 Identity:65/359 - (18%)
Similarity:120/359 - (33%) Gaps:114/359 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ADKAGIRLGDIILEINEEDASQLTLS------------------------QAHEKINSTPKKIHF 116
            |::.|:||||.:||:|..|...|.:|                        ||:...|..|.:...
  Fly    39 AERGGVRLGDTLLELNGADVLGLKISELANRLQDHWQSGAEVVTLMMWRQQANIDPNEDPAEASH 103

  Fly   117 LLRNMEEDDPMGQFEAG-EEKSIVMRVP---KPLPPP-----SGRI-----RASSIEM------- 160
            .:::......:.:|... :..|.::..|   :.:.||     :|.:     |:.|::.       
  Fly   104 AVQHGINQQSLQKFATCLQHISQLLECPVCLEVIKPPGWQCCNGHVLCNNCRSRSVKCPVCRVPL 168

  Fly   161 ----RLLEMQRKLSAIAEIPKILC----STLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYD 217
                |.|...:..:.:||  ...|    :.....||..|::|......::...:......|.|..
  Fly   169 GPRGRCLLSDKLFTLLAE--SFPCDGGKTNKVAASQGHGKLSSVNKCTNEYHNQPKMALAKTSSG 231

  Fly   218 EDALDFELRNGEQAGDTDSDEEDLVLVREEDAEDVDVPKGAKQSKLLKDVTPESDYASEANYPAN 282
            :          .:.|...|.:.:.|||.:..                :::..:|....|......
  Fly   232 K----------SKCGKQISRQLETVLVDQSP----------------REIRRKSQQGQEQEQAVQ 270

  Fly   283 EASDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKL------- 340
            ||.         .|..|:..::...||.|  :.|.|..:           |:...|||       
  Fly   271 EAV---------LPRCTLIKVQHQEAAVE--HFSEEGHN-----------NMLVKPKLKLSKKSW 313

  Fly   341 RINDAEAEG----ELTLGHQAREVPQQEQPQEKQ 370
            ||...:.:|    |:...:...:|.:|:|.||:|
  Fly   314 RITGPDQDGLRCDEVATINNGVQVQEQQQQQERQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 16/66 (24%)
CG34375NP_001163693.1 PDZ 13..86 CDD:238080 12/46 (26%)
RING 129..168 CDD:238093 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.