DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and loco

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster


Alignment Length:531 Identity:103/531 - (19%)
Similarity:178/531 - (33%) Gaps:169/531 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEQLGLLWSVPESKSKAPI----IKVSCG---IGD----TDGYPAFDVD--SDAYATKDDSRWG 52
            |.:....|...|.....||:    :|:.||   :.|    .....:||..  :.......:|.:.
  Fly  1008 MADMQHALMPAPPVPQNAPLTSASLKLVCGQNSLSDLHSSRSSLSSFDAGTATGGQGASTESVYS 1072

  Fly    53 F---LITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKI---NSTP 111
            .   ::|.||     .|:.|..|           |:.:.|:.|....:..|...:..|   .|| 
  Fly  1073 LCRVILTDGA-----TTIVQTRP-----------GETVGELVERLLEKRNLVYPYYDIVFQGST- 1120

  Fly   112 KKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIP 176
                   ::::...| .|..||:|..|..||...|..|.                         |
  Fly  1121 -------KSIDVQQP-SQILAGKEVVIERRVAFKLDLPD-------------------------P 1152

  Fly   177 KILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGD-----TDS 236
            |::              |.....:..:.|....:..|::|..:.:...:|:.:...|     |.:
  Fly  1153 KVI--------------SVKSKPKKQLHEVIRPILSKYNYKMEQVQVIMRDTQVPIDLNQPVTMA 1203

  Fly   237 DEEDLVLVREEDAEDVDVPKGA----KQSKLLKDVTPESDY-------------------ASEAN 278
            |.:.|.:|...  .|..|..|:    ||||.:|.: |:...                   |||.:
  Fly  1204 DGQRLRIVMVN--SDFQVGGGSSMPPKQSKPMKPL-PQGHLDELTNKVFNELLASKADAAASEKS 1265

  Fly   279 YP-------ANEASDDTES-----DDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYT 331
            .|       :|||..:|.|     ..:...|..:...|||....:.|.||.:.|:.:    ||..
  Fly  1266 RPVDLCSMKSNEAPSETSSLFERMRRQQRDGGNIPASKLPKLKKKSTSSSQQSEEAA----TTQA 1326

  Fly   332 ---------WNLRNVPKLRIND--AEAEGELTLGHQAREVPQQE---------------QPQEKQ 370
                     ..|:...||::.:  ||.:.||..|.:..::.:.|               :.:|..
  Fly  1327 VADPKKPIIAKLKAGVKLQVTERVAEHQDELLEGLKRAQLARLEDQRGTEINFDLPDFLKNKENL 1391

  Fly   371 PCLEPEPPKVR---------PATPT--PKAPPQESAEGQTQKLL-FRLD-KLERSWPWADREKII 422
            .....:..|||         |||||  |:..|:.|.....|.:. .::| :.|...|.|.:::..
  Fly  1392 SAAVSKLRKVRASLSPVSKVPATPTEIPQPAPRLSITRSQQPVSPMKVDQEPETDLPAATQDQTE 1456

  Fly   423 YKQSTCHLVPR 433
            :.::...|.|:
  Fly  1457 FAKAPPPLPPK 1467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 14/79 (18%)
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412 21/96 (22%)
RBD 1144..1213 CDD:128731 14/107 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.