DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Mhcl

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_732109.2 Gene:Mhcl / 41955 FlyBaseID:FBgn0026059 Length:2194 Species:Drosophila melanogaster


Alignment Length:412 Identity:80/412 - (19%)
Similarity:136/412 - (33%) Gaps:129/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EEDASQLTLSQAHEKINSTPKKIHFLLRNMEEDDPMGQFEAG-EEKSIVMRVPKPLPPPSGRIRA 155
            |:...:.||:.....:....:|:..|.|.:||    ..|..| ||:...:|..|    .....||
  Fly  1629 EKFTLEQTLADTRLDLEFKEEKLASLQRELEE----MTFGGGTEEEFAQLRRSK----NETERRA 1685

  Fly   156 SSIEMRLLEMQRKLSAIAEIPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDA 220
            ...|..|.||..::..:.:....|..||.|:.:...|.|:...:|.:......|.:.|      |
  Fly  1686 KEQEEELDEMAGQIQLLEQAKLRLEMTLETMRKEARRESQQRDEELEEVRGNGYKKIK------A 1744

  Fly   221 LDFELRNGEQAGDTDSDEEDLVL------------VREEDAEDVDVPKGAKQSKLLKDVTPESDY 273
            |:.:|       :|:.:|..|:|            :.:.|..|.|..:...| ||.:|:      
  Fly  1745 LECQL-------ETEHEERTLLLREKHELERRLSSMEDRDRVDRDAEEALNQ-KLRRDL------ 1795

  Fly   274 ASEANYPA--NEASDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRN 336
               ..|.|  .:|....|....|.||.|:                                    
  Fly  1796 ---RKYKALLKDAQTQLERLKADTPGKTL------------------------------------ 1821

  Fly   337 VPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQPCLEPEPPKVRPATPTPKAPPQESAEGQTQ- 400
            :.:||....:||...:|..:||:..:.|. .|.|...:........|.....|..::.||.|.| 
  Fly  1822 IRQLRNQLEDAESARSLAMKARQTAEAEL-TEVQAMFDESHRARNDAEERANAAHRDRAELQAQI 1885

  Fly   401 ------------------KLL-----------FRLDKLERSWPWADREKIIYKQSTCHLVPR--- 433
                              |.|           |:|:::|     |:|..:  |:....|..|   
  Fly  1886 EENEEELGELMKKYSATVKQLNTEQINVSEAEFKLNEME-----AERNNL--KEQVAELQHRLDN 1943

  Fly   434 ------KPLGLVGQRMQLLLKD 449
                  ..:.::.:|::|..|:
  Fly  1944 VENLGDPSMAMMSKRLELRTKE 1965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 5/26 (19%)
MhclNP_732109.2 PDZ_signaling 339..426 CDD:238492
MYSc 556..1317 CDD:214580
MYSc_Myo18 575..1305 CDD:276837
GBP_C <1540..1750 CDD:303769 32/141 (23%)
COG1340 1565..1833 CDD:224259 53/270 (20%)
coiled coil 1723..1734 CDD:293879 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.