DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and dysc

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001261810.1 Gene:dysc / 39533 FlyBaseID:FBgn0264006 Length:1254 Species:Drosophila melanogaster


Alignment Length:284 Identity:57/284 - (20%)
Similarity:112/284 - (39%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIHF 116
            |.:|.||.|:.:.:.|..|..:.:||::|:.:||.|||:|.:....:|..:|..:: ...|::..
  Fly   477 GLMIRGGVEYGLGIFVTGVDKDSVADRSGLMIGDEILEVNGQSFLDVTHDEAVGQL-KYHKRMSL 540

  Fly   117 LLRNME---------EDDPMGQF--------EAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLE 164
            ::|::.         |.:|...:        ..|:..::|....:.|.|   |...:|:...:.|
  Fly   541 VIRDVGKVPHSCTSIEMEPWDAYSPTGTRARRKGQIATMVEEKARSLLP---RHHFASLSYYIAE 602

  Fly   165 MQRKLSAIAEIPKILCSTLATVSQN--FGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRN 227
            ...|...|.....:|...|.|..::  ...:.|....||....:|...:|:  .|..::|...|.
  Fly   603 YSAKAMTIDAFVAVLLEMLDTYEKHTLVTEIRELVFPEDRTRYDELVYRRE--RDPYSVDRHRRK 665

  Fly   228 GEQAGDTDSDEEDLVLV----REEDAED------VDV-----------PKGAKQSKLLKDVTPES 271
            |:.|.|.....:||.::    |...::.      .|:           |..|  ..:|....|.|
  Fly   666 GDPARDLPVTADDLEIIAATGRSPSSDSGLGMTVTDIYKRPALQLPHRPMSA--GPILHRSQPAS 728

  Fly   272 DYASEANYPANEASDDTESDDEDE 295
            .|.:.:|..::..|...:...:.:
  Fly   729 HYQTGSNQSSSSLSPPQQQQQQQQ 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 19/66 (29%)
dyscNP_001261810.1 PDZ_signaling 294..380 CDD:238492
PDZ_signaling 466..543 CDD:238492 19/66 (29%)
HN_L-whirlin_R2_like 573..653 CDD:259823 16/82 (20%)
PDZ_signaling 886..971 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.