DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and pdlim7

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_957134.1 Gene:pdlim7 / 393813 ZFINID:ZDB-GENE-040426-2092 Length:419 Species:Danio rerio


Alignment Length:124 Identity:39/124 - (31%)
Similarity:59/124 - (47%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTPKKIH 115
            |||.:.||.:|:.||||.::||.|.|.:||:.:||.::.|.:.:|.::|..:|..||.:....:.
Zfish    14 WGFRLQGGKDFNTPLTVSRLTPGGKAAQAGVGVGDWVVSIFDANAEEMTHVEAQNKIRAATDSLK 78

  Fly   116 FLLRNMEEDDPMGQFEAGEEKSIV---MRVPKPLPPPSGRIRASSIEMRLLEMQRKLSA 171
            ..|.....  |.|    ||:|..:   ...||....||..|.         :|.|..||
Zfish    79 LTLSRAFH--PAG----GEQKDSLTSSSSQPKYSFAPSTAIN---------KMARPFSA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 24/67 (36%)
pdlim7NP_957134.1 PDZ_signaling 3..81 CDD:238492 24/66 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..232
LIM1_Enigma 244..295 CDD:188836
LIM2_Enigma 303..354 CDD:188840
LIM3_Enigma 362..416 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.