DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and inaD

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001246470.1 Gene:inaD / 37629 FlyBaseID:FBgn0001263 Length:686 Species:Drosophila melanogaster


Alignment Length:317 Identity:65/317 - (20%)
Similarity:111/317 - (35%) Gaps:81/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WGFLITGGAEFHMPLT------VFQVTPNGLADKAG-IRLGDIILEINEEDASQLTLSQAHEKIN 108
            :|..|..|.....|.|      :..:.|:..|...| :::||.||.:|.:|....|.....:.|.
  Fly    40 FGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIK 104

  Fly   109 STPKKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIA 173
            ....||...::..::.|        |:::      |..|..:|.::|.:   :..:.|       
  Fly   105 EADFKIELEIQTFDKSD--------EQQA------KSDPRSNGYMQAKN---KFNQEQ------- 145

  Fly   174 EIPKILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDE 238
                 ..:..|:..|..|:       ....|:..|.:.|:.|..:....| ..:..|.....:||
  Fly   146 -----TTNNNASGGQGMGQ-------GQGQGQGMAGMNRQQSMQKRNTTF-TASMRQKHSNYADE 197

  Fly   239 EDLVLVREEDAEDVDVPKGAKQSKLLKDVTPESDYASEANYPANEASDDTESDDEDEPGSTVYFM 303
            :|      ||..|:       ..::..:...|.|.||..|...|:...|.:.:.|||.|.|:   
  Fly   198 DD------EDTRDM-------TGRIRTEAGYEIDRASAGNCKLNKQEKDRDKEQEDEFGYTM--- 246

  Fly   304 KLPAAAAEDTYSSTEDEDDSDFLNTTYTWNLRNVPKLRINDAEAEGELTL-GHQARE 359
                |.....|:..:|              ||.:...|  ||.....|.| ||:.|:
  Fly   247 ----AKINKRYNMMKD--------------LRRIEVQR--DASKPLGLALAGHKDRQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 18/74 (24%)
inaDNP_001246470.1 PDZ_signaling 27..115 CDD:238492 18/74 (24%)
PDZ_signaling 259..340 CDD:238492 10/27 (37%)
PDZ_signaling 377..457 CDD:238492
PDZ_signaling 500..584 CDD:238492
PDZ_signaling 597..672 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.