DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42319 and Zasp52

DIOPT Version :9

Sequence 1:NP_001137648.1 Gene:CG42319 / 36473 FlyBaseID:FBgn0259219 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster


Alignment Length:346 Identity:66/346 - (19%)
Similarity:121/346 - (34%) Gaps:104/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DDSRWGFLITGGAEFHMPLTVFQVTPNGLADKAGIRLGDIILEINEEDASQLTLSQAHEKINSTP 111
            |...|||.:.||.:|..||.|.:|....|:::||::.||.:::||:.|.                
  Fly    15 DAQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQPGDAVVKINDVDV---------------- 63

  Fly   112 KKIHFLLRNMEEDDPMGQFEAGEEKSIVMRVPKPLPPPSGRIRASSIEMRLLEMQRKLSAIAEIP 176
                |.||:.:..|            ||:|        ||.....:::......:..::....:|
  Fly    64 ----FNLRHKDAQD------------IVVR--------SGNNFVITVQRGGSTWRPHVTPTGNVP 104

  Fly   177 KILCSTLATVSQNFGRMSESEVDEDDVGEEEAYVQRKFSYDEDALDFELRNGEQAGDTDSDEEDL 241
            :.....|.||::.  .::..:.|...:|         ..|:..|..|.  ||...|         
  Fly   105 QPNSPYLQTVTKT--SLAHKQQDSQHIG---------CGYNNAARPFS--NGGDGG--------- 147

  Fly   242 VLVREEDAEDVDVPKGA-KQSKLLKDVTPESDYAS----EANYPANEASDDTESDDEDEPGSTVY 301
              |:....:..:.|.|. ....:.:.::.:::..:    ..|:..|      |.:.:.:....:.
  Fly   148 --VKSIVNKQYNTPVGIYSDESIAETLSAQAEVLAGGVLGVNFKKN------EKEYQGDRSEVLK 204

  Fly   302 FMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNL---RNVPKLRINDAEAEGELTLGHQAREVPQQ 363
            |::     .|:|..||     ..|.|:.|..:.   ...|:.:.|.          ||.....||
  Fly   205 FLR-----EEETGQST-----PAFGNSHYEHDAPQQLQQPQQQYNQ----------HQQHYHQQQ 249

  Fly   364 EQPQE------KQPCLEPEPP 378
            :|.|.      ..|...|:||
  Fly   250 QQQQSSTTRHVSAPVNSPKPP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42319NP_001137648.1 PDZ_signaling 45..119 CDD:238492 20/71 (28%)
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492 28/111 (25%)
DUF4749 150..>217 CDD:292558 10/82 (12%)
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839
LIM 2081..2132 CDD:259829
LIM3_Enigma_like_1 2140..2193 CDD:188845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.